Overview

  • Product name

  • Description

    Rabbit polyclonal to ATP5H
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human ATP5H aa 1-161.
    Sequence:

    MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPP AIDWAYYKANVAKAGLVDDFEKKFNALKVPVPEDKYTAQVDAEEKEDVKS CAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKY PYWPHQPIENL


    Database link: O75947

  • Positive control

    • WB: Mouse kidney, liver and brain lysates; HeLa, HepG2 and PC-3 whole cell lysates. IHC-P: Human brain and small intestine tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab230101 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 18 kDa (predicted molecular weight: 16,18 kDa).
IHC-P 1/20 - 1/200.

Target

  • Function

    Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a/ATP6 static relative to the rotary elements.
  • Sequence similarities

    Belongs to the ATPase d subunit family.
  • Cellular localization

    Mitochondrion. Mitochondrion inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ATP synthase D chain mitochondrial antibody
    • ATP synthase H+ transporting mitochondrial F1F0 subunit antibody
    • ATP synthase H+ transporting mitochondrial F1F0 subunit d antibody
    • ATP synthase subunit d antibody
    • ATP synthase subunit d, mitochondrial antibody
    • ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d antibody
    • ATP5H antibody
    • ATP5H_HUMAN antibody
    • ATP5JD antibody
    • ATPase subunit d antibody
    • ATPQ antibody
    • mitochondrial antibody
    • My032 protein antibody
    see all

Images

  • All lanes : Anti-ATP5H antibody (ab230101) at 1/1000 dilution

    Lane 1 : Mouse kidney lysate
    Lane 2 : Mouse liver lysate
    Lane 3 : Mouse brain lysate
    Lane 4 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 5 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 6 : PC-3 (human prostate adenocarcinoma cell line) whole cell lysate
    Lane 7 : U-251 MG (human brain glioma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 16,18 kDa
    Observed band size: 18 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human brain tissue stained for ATP5H using ab230101 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human small intestine tissue stained for ATP5H using ab230101 at 1/100 dilution in immunohistochemical analysis.

References

ab230101 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230101.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up