Overview

  • Product name

    Anti-ATP5J antibody
  • Description

    Rabbit polyclonal to ATP5J
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human ATP5J aa 1-104.
    Sequence:

    MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREY KSKRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKF EVIE


    Database link: P18859

  • Positive control

    • WB: RT4 and U-251 MG cell lysates; Human liver and tonsil tissue lysates. IHC-P: Human liver tissue. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224139 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 13 kDa.
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a/ATP6 static relative to the rotary elements. Also involved in the restoration of oligomycin-sensitive ATPase activity to depleted F1-F0 complexes.
  • Sequence similarities

    Belongs to the eukaryotic ATPase subunit F6 family.
  • Cellular localization

    Mitochondrion. Mitochondrion inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F6 antibody
    • ATP synthase-coupling factor 6, mitochondrial antibody
    • ATP synthase-coupling factor 6, mitochondrial antibody
    • ATP5 antibody
    • ATP5A antibody
    • ATP5J antibody
    • ATP5J_HUMAN antibody
    • ATPase subunit F6 antibody
    • ATPM antibody
    • CF6 antibody
    • F6 antibody
    see all

Images

  • All lanes : Anti-ATP5J antibody (ab224139) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (human brain glioma cell line) cell lysate
    Lane 3 : Human plasma (IgG/HSA depleted)
    Lane 4 : Human liver tissue lysate
    Lane 5 : Human tonsil tissue lysate

    Developed using the ECL technique.

    Predicted band size: 13 kDa

  • Paraffin-embedded human liver tissue stained for ATP5J using ab224139 at 1/500 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for ATP5J (green) using ab224139 at 4 µg/ml in ICC/IF.

References

ab224139 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224139.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up