For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    By product type
    Proteins and Peptides
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Lysates
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    • Protocols & troubleshooting
    • Technical FAQs
    • Get technical help
    • RabMAb Advantages
    • Buying FAQs
    • Antibody Guide
    • Scientific webinars
    • Biochemical product FAQ
    • Support resources
    • eProcurement
    Check out our protocols

    Visit protocols and troubleshooting or check them out using the Abcam app for iPhone

    Protocols and troubleshooting

    iPhone app

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    atp5j2-antibody-ab200715.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Protein Trafficking Organelle Proteins
Share by email

Anti-ATP5J2 antibody (ab200715)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

  • Western blot - Anti-ATP5J2 antibody (ab200715)

Add compatible products

Primary

Product image

 

Secondary

Product image

 

Protein

Product image

 

Unfortunately, one or more of the products below are unavailable in your country/region.

Sorry, we can't display this right now.
Please contact us to place your order, or try again later.

View more associated products

  • Datasheet
  • References
  • Protocols

Overview

  • Product name

    Anti-ATP5J2 antibody
  • Description

    Rabbit polyclonal to ATP5J2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Orangutan
  • Immunogen

    Synthetic peptide within Human ATP5J2 aa 32-77. The exact sequence is proprietary.
    Sequence:

    MRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFS


    Database link: P56134

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • HEK293T, Raw 264.7 and H9C2 whole cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.1% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab200715 was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen and the purity is >95% (by SDS-PAGE).
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Signal Transduction
    • Protein Trafficking
    • Organelle Proteins
    • Signal Transduction
    • Protein Trafficking
    • Vesicle Transport
    • Regulation
    • Signal Transduction
    • Metabolism
    • Plasma Membrane
    • ATPases
    • Signal Transduction
    • Metabolism
    • Mitochondrial
    • Metabolism
    • Pathways and Processes
    • Mitochondrial Metabolism
    • Mitochondrial markers

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
  • Positive Controls

    • RAW 264.7 whole cell lysate (ab7187)
  • Recombinant Protein

    • Recombinant Human ATP5J2 protein (ab160543)
  • Related Products

    • Recombinant Human ATP5J2 protein (ab160543)

Applications

Our Abpromise guarantee covers the use of ab200715 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 11 kDa.

Target

  • Relevance

    ATP5J2 is part of the complex F0 domain of the mitochondrial ATP synthase. This produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. It is composed of two complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, which comprises the proton channel. ATP5J2 encodes the f subunit of the Fo complex. There are 2 isoforms produced by alternative splicing.
  • Cellular localization

    Mitochondrial; Mitochondrion inner membrane
  • Database links

    • Entrez Gene: 9551 Human
    • Entrez Gene: 57423 Mouse
    • Entrez Gene: 100173467 Orangutan
    • Entrez Gene: 690441 Rat
    • SwissProt: P56134 Human
    • SwissProt: P56135 Mouse
    • SwissProt: Q5R6T5 Orangutan
    • SwissProt: D3ZAF6 Rat
    • Unigene: 521056 Human
    • Unigene: 656515 Human
    • Unigene: 133551 Mouse
    • Unigene: 3543 Rat
    see all
  • Alternative names

    • ATP synthase f chain, mitochondrial antibody
    • ATP synthase subunit f, mitochondrial antibody
    • ATP synthase, H+ transporting, mitochondrial F0 complex, subunit f, isoform 2 antibody
    • ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F2 antibody
    • ATP5JL antibody
    • F1F0-type ATPase subunit f antibody
    • F1Fo-ATP synthase complex Fo membrane domain f subunit antibody
    • F1Fo-ATPase synthase f subunit antibody
    see all

Images

  • Western blot - Anti-ATP5J2 antibody (ab200715)
    Western blot - Anti-ATP5J2 antibody (ab200715)
    All lanes : Anti-ATP5J2 antibody (ab200715) at 1/500 dilution

    Lane 1 : HEK293T whole cell lysate
    Lane 2 : Raw 264.7 whole cell lysate
    Lane 3 : H9C2 whole cell lysate

    Predicted band size: 11 kDa

Protocols

  • Western blot protocols

Datasheets and documents

    • Datasheet
    • SDS
  • References

    ab200715 has not yet been referenced specifically in any publications.

    Publishing research using ab200715? Please let us know so that we can cite the reference in this datasheet.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab200715.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & advice
    • Buying FAQs
    • RabMAb products
    • Biochemical product FAQs
    Company
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2019 Abcam plc. All rights reserved.