Anti-ATP5J2 antibody (ab200715)

Submit a review Submit a question

Key features and details

  • Rabbit polyclonal to ATP5J2
  • Suitable for: WB
  • Reacts with: Mouse, Rat, Human
  • Isotype: IgG

Overview

  • Product name

    Anti-ATP5J2 antibody

  • Description

    Rabbit polyclonal to ATP5J2

  • Host species

    Rabbit

  • Tested applications

    Suitable for: WBmore details

  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Orangutan

  • Immunogen

    Synthetic peptide within Human ATP5J2 aa 32-77. The exact sequence is proprietary.
    Sequence:

    MRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFS


    Database link: P56134

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • HEK293T, Raw 264.7 and H9C2 whole cell lysates.

  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

Applications

Our Abpromise guarantee covers the use of ab200715 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 11 kDa.

Target

  • Relevance

    ATP5J2 is part of the complex F0 domain of the mitochondrial ATP synthase. This produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. It is composed of two complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, which comprises the proton channel. ATP5J2 encodes the f subunit of the Fo complex. There are 2 isoforms produced by alternative splicing.

  • Cellular localization

    Mitochondrial; Mitochondrion inner membrane

  • Database links

    see all

  • Alternative names

    • ATP synthase f chain, mitochondrial antibody
    • ATP synthase subunit f, mitochondrial antibody
    • ATP synthase, H+ transporting, mitochondrial F0 complex, subunit f, isoform 2 antibody
    • ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F2 antibody
    • ATP5JL antibody
    • F1F0-type ATPase subunit f antibody
    • F1Fo-ATP synthase complex Fo membrane domain f subunit antibody
    • F1Fo-ATPase synthase f subunit antibody
    see all

Images

  • Western blot - Anti-ATP5J2 antibody (ab200715)
    Western blot - Anti-ATP5J2 antibody (ab200715)
    All lanes : Anti-ATP5J2 antibody (ab200715) at 1/500 dilution

    Lane 1 : HEK293T whole cell lysate
    Lane 2 : Raw 264.7 whole cell lysate
    Lane 3 : H9C2 whole cell lysate

    Predicted band size: 11 kDa

References (0)

Publishing research using ab200715? Please let us know so that we can cite the reference in this datasheet.

ab200715 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab200715.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com