Anti-ATP5J2 antibody (ab200715)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-ATP5J2 antibody -
Description
Rabbit polyclonal to ATP5J2 -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Mouse, Rat, Human
Predicted to work with: Orangutan -
Immunogen
Synthetic peptide within Human ATP5J2 aa 32-77. The exact sequence is proprietary.
Sequence:MRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFS
Database link: P56134 -
Positive control
- HEK293T, Raw 264.7 and H9C2 whole cell lysates.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.1% Sodium azide
Constituent: 99% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab200715 was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen and the purity is >95% (by SDS-PAGE). -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab200715 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use at an assay dependent concentration. Predicted molecular weight: 11 kDa. |
Target
-
Relevance
ATP5J2 is part of the complex F0 domain of the mitochondrial ATP synthase. This produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. It is composed of two complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, which comprises the proton channel. ATP5J2 encodes the f subunit of the Fo complex. There are 2 isoforms produced by alternative splicing. -
Cellular localization
Mitochondrial; Mitochondrion inner membrane -
Database links
- Entrez Gene: 9551 Human
- Entrez Gene: 57423 Mouse
- Entrez Gene: 100173467 Orangutan
- Entrez Gene: 690441 Rat
- SwissProt: P56134 Human
- SwissProt: P56135 Mouse
- SwissProt: Q5R6T5 Orangutan
- SwissProt: D3ZAF6 Rat
see all -
Alternative names
- ATP synthase f chain, mitochondrial antibody
- ATP synthase subunit f, mitochondrial antibody
- ATP synthase, H+ transporting, mitochondrial F0 complex, subunit f, isoform 2 antibody
see all
Images
Protocols
References
ab200715 has not yet been referenced specifically in any publications.