Overview

  • Product name

    Anti-ATP6J/ATP6V1G1 antibody
    See all ATP6J/ATP6V1G1 primary antibodies
  • Description

    Rabbit polyclonal to ATP6J/ATP6V1G1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human ATP6J/ATP6V1G1 aa 42-115.
    Sequence:

    AEIEQYRLQREKEFKAKEAAALGSRGSCSTEVEKETQEKMTILQTYFRQN RDEVLDNLLAFVCDIRPEIHENYR


    Database link: O75348

  • Positive control

    • RT-4 and U-251 MG cell lysates; Human liver lysate; PC-3 cells.
  • General notes

     This product was previously labelled as ATP6J

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220044 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/100 - 1/250. Predicted molecular weight: 14 kDa.

Target

  • Function

    Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the V-ATPase G subunit family.
  • Information by UniProt
  • Database links

  • Alternative names

    • ATP 6G antibody
    • ATP 6J antibody
    • ATP6G antibody
    • ATP6G1 antibody
    • ATP6GL antibody
    • Atp6v1g1 antibody
    • ATPase H+ transporting lysosomal (vacuolar proton pump) member J antibody
    • ATPase H+ transporting lysosomal 13kD V1 subunit G isoform 1 antibody
    • ATPase H+ transporting lysosomal 13kDa V1 subunit G1 antibody
    • ATPase H+ transporting lysosomal member J antibody
    • ATPase H+ transporting lysosomal subunit G isoform 1 antibody
    • DKFZp547P234 antibody
    • V ATPase 13 kDa subunit 1 antibody
    • V ATPase G subunit 1 antibody
    • V-ATPase 13 kDa subunit 1 antibody
    • V-ATPase subunit G 1 antibody
    • V-type proton ATPase subunit G 1 antibody
    • Vacuolar ATP synthase subunit G 1 antibody
    • Vacuolar ATP synthase subunit G1 antibody
    • Vacuolar ATP synthase subunit M16 antibody
    • Vacuolar H+ ATPase G1 antibody
    • Vacuolar H+ ATPase subunit G 1 antibody
    • Vacuolar proton pump G subunit 1 antibody
    • Vacuolar proton pump subunit G 1 antibody
    • Vacuolar proton pump subunit M16 antibody
    • VATG1_HUMAN antibody
    • Vma 10 antibody
    • Vma10 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized PC-3 cells labeling ATP6J/ATP6V1G1 with ab220044 at 4 μg/ml (green).

  • All lanes : Anti-ATP6J/ATP6V1G1 antibody (ab220044) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Human plasma
    Lane 4 : Human liver lysate

    Predicted band size: 14 kDa

References

This product has been referenced in:

  • Maschalidi S  et al. UNC93B1 interacts with the calcium sensor STIM1 for efficient antigen cross-presentation in dendritic cells. Nat Commun 8:1640 (2017). Read more (PubMed: 29158474) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220044.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up