Overview

  • Product name

    Anti-ATP6V0D1/P39 antibody
    See all ATP6V0D1/P39 primary antibodies
  • Description

    Mouse monoclonal to ATP6V0D1/P39
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IF, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ATP6V0D1/P39 aa 238-309.
    Sequence:

    AKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGD KTLEDRFFEHEVKLNKLAFLN

  • General notes

    This product was changed from ascites to tissue culture supernatant on 13th Feb 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

     This product was previously labelled as ATP6V0D1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab56441 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 40 kDa.
IHC-P Use at an assay dependent concentration.
ICC/IF Use at an assay dependent concentration.
Flow Cyt Use at an assay dependent concentration.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

Target

  • Function

    Subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. May play a role in coupling of proton transport and ATP hydrolysis (By similarity). May play a role in cilium biogenesis through regulation of the transport and the localization of proteins to the cilium.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the V-ATPase V0D/AC39 subunit family.
  • Cellular localization

    Membrane. Localizes to centrosome and the base of the cilium.
  • Information by UniProt
  • Database links

  • Alternative names

    • 32 kDa accessory protein antibody
    • ATP6D antibody
    • ATP6DV antibody
    • ATP6V0D1 antibody
    • ATPase H+ transporting lysosomal (vacuolar proton pump) member D antibody
    • ATPase H+ transporting lysosomal 38kD V0 subunit d antibody
    • ATPase H+ transporting lysosomal 38kDa V0 subunit d1 antibody
    • ATPase H+ transporting lysosomal V0 subunit d1 antibody
    • H(+) transporting two sector ATPase subunit D antibody
    • p39 antibody
    • V ATPase 40 KDa accessory protein antibody
    • V ATPase AC39 subunit antibody
    • V ATPase subunit d 1 antibody
    • V ATPase subunit D antibody
    • V-ATPase 40 kDa accessory protein antibody
    • V-ATPase AC39 subunit antibody
    • V-ATPase subunit d 1 antibody
    • V-type proton ATPase subunit d 1 antibody
    • VA0D1_HUMAN antibody
    • Vacuolar ATP synthase subunit d 1 antibody
    • Vacuolar proton pump subunit d 1 antibody
    • VATX antibody
    • VMA 6 antibody
    • VMA6 antibody
    • VPATPD antibody
    see all

Images

  • ATP6V0D1/P39 antibody (ab56441) at 1ug/lane + HeLa cell lysate at 25ug/lane.

    This image was generated using the ascites version of the product.

  • ATP6V0D1/P39 antibody (ab56441) used in immunohistochemistry at 5ug/ml on formalin fixed and paraffin embedded human stomach.

    This image was generated using the ascites version of the product.

  • ICC/IF image of ab56441 stained HeLa cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab56441, 10µg/ml) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-mouse IgG (H+L) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

    This image was generated using the ascites version of the product.

  • Overlay histogram showing HeLa cells stained with ab56441 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab56441, 1μg/1x106 cells) for 30 min at 22°C. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22°C. Isotype control antibody (black line) was a mix of mouse IgG1 [ICIGG1], (ab91353, 2μg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in HeLa cells fixed with 4%PFA/permeabilized in 0.1% PBS-Tween used under the same conditions.

    This image was generated using the ascites version of the product.

References

This product has been referenced in:

  • Fletcher K  et al. The WD40 domain of ATG16L1 is required for its non-canonical role in lipidation of LC3 at single membranes. EMBO J 37:N/A (2018). Read more (PubMed: 29317426) »
  • McGuire CM & Forgac M Glucose starvation increases V-ATPase assembly and activity in mammalian cells through AMP kinase and phosphatidylinositide 3-kinase/Akt signaling. J Biol Chem 293:9113-9123 (2018). Read more (PubMed: 29540478) »
See all 9 Publications for this product

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Application
Western blot
Sample
Pig Cell lysate - other (LLC-PK1)
Gel Running Conditions
Non-reduced Denaturing (4-15%)
Loading amount
10 µg
Specification
LLC-PK1
Blocking step
Milk as blocking agent for 30 minute(s) · Concentration: 1.5% · Temperature: 21°C

Dr. Christina Mcguire

Verified customer

Submitted Dec 22 2015

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up