Overview

  • Product name

  • Description

    Mouse polyclonal to ATP6V0D2
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human ATP6V0D2 aa 238-306. NP_689778
    Sequence:

    ETLYPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGK TLEDVFYEREVQMNVLAFN


    Database link: Q8N8Y2

  • Positive control

    • Y79 cell lysate; recombinant immunogen

Properties

  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Constituent: 50% Glycerol
  • Concentration information loading...
  • Purity

    Whole antiserum
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab194557 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2500. Predicted molecular weight: 40 kDa.

Target

  • Relevance

    Vacuolar ATPase (V ATPase) is a heteromultimeric enzyme composed of a peripheral catalytic V1 complex (components A to H) attached to an integral membrane V0 proton pore complex (components: a, c, c', c'' and d). It is responsible for acidifying a variety of intracellular organelles in eukaryotic cells. ATP6V0D2 is a component of the integral membrane V0 complex of vacuolar ATPase and may have a role in coupling of proton transport and ATP hydrolysis. ATP6V0D2 may be involved in regulation of osteoclast fusion and bone formation.
  • Cellular localization

    Apical plasma membrane
  • Database links

  • Alternative names

    • ATP6D2 antibody
    • ATPase H+ transporting lysosomal 38kDa V0 subunit D antibody
    • ATPase H+ transporting lysosomal 38kDa V0 subunit D isoform 2 antibody
    • ATPase H+ transporting lysosomal 38kDa V0 subunit D2 antibody
    • FLJ38708 antibody
    • V ATPase subunit d 2 antibody
    • Vacuolar ATP synthase subunit d 2 antibody
    • Vacuolar proton pump subunit d 2 antibody
    • VMA 6 antibody
    • VMA6 antibody
    see all

Images

  • Anti-ATP6V0D2 antibody (ab194557) at 1/500 dilution + Y79 cell lysate at 50 µg

    Predicted band size: 40 kDa

  • Anti-ATP6V0D2 antibody (ab194557) at 1/1000 dilution + recombinant immunogen at 0.2 µg

    Predicted band size: 40 kDa



    Expected MW of immunogen is 33.7 kDa.

References

This product has been referenced in:

  • Liu N  et al. Lactate inhibits ATP6V0d2 expression in tumor-associated macrophages to promote HIF-2a-mediated tumor progression. J Clin Invest N/A:N/A (2019). Read more (PubMed: 30431439) »
  • Zhu X  et al. V?9Vd2 T cells inhibit immature dendritic cell transdifferentiation into osteoclasts through downregulation of RANK, c-Fos and ATP6V0D2. Int J Mol Med 42:2071-2079 (2018). Read more (PubMed: 30066839) »
See all 2 Publications for this product

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Application
Western blot
Sample
Cow Cell lysate - whole cell (Bovine aortic endothelial cell)
Gel Running Conditions
Reduced Denaturing
Loading amount
10 µg
Specification
Bovine aortic endothelial cell
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 20°C

Abcam user community

Verified customer

Submitted Sep 19 2015

Application
Western blot
Sample
Rat Cell lysate - whole cell (RBL-2H3 cells)
Gel Running Conditions
Reduced Denaturing
Loading amount
10 µg
Specification
RBL-2H3 cells
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 20°C

Abcam user community

Verified customer

Submitted Jun 15 2015

Application
Western blot
Loading amount
20 µg
Gel Running Conditions
Reduced Denaturing (16%)
Sample
Mouse Cell lysate - whole cell (Bone marrow derived macrophage)
Specification
Bone marrow derived macrophage
Blocking step
Milk as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Mar 13 2015

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up