Overview

  • Product name

  • Description

    Mouse polyclonal to ATP6V1C1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Xenopus laevis, Cynomolgus monkey, Orangutan, Xenopus tropicalis
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human ATP6V1C1 aa 1-110 (N terminal). NP_001686
    Sequence:

    MTEFWLISAPGEKTCQQTWEKLHAATSKNNNLAVTSKFNIPDLKVGTLDV LVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVT YITRFQWDMA


    Database link: P21283

  • Positive control

    • Human ovarian cancer tissue lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Constituent: 50% Glycerol
  • Purity

    Whole antiserum
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab194489 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 44 kDa.

Target

  • Function

    Subunit of the peripheral V1 complex of vacuolar ATPase. Subunit C is necessary for the assembly of the catalytic sector of the enzyme and is likely to have a specific function in its catalytic activity. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the V-ATPase C subunit family.
  • Information by UniProt
  • Database links

  • Alternative names

    • ATP6C antibody
    • ATP6D antibody
    • ATP6V1C1 antibody
    • ATPase H+ transporting lysosomal (vacuolar proton pump) 42kD antibody
    • ATPase H+ transporting lysosomal 42kD V1 subunit C isoform 1 antibody
    • ATPase H+ transporting lysosomal 42kDa V1 subunit C isoform 1 antibody
    • ATPase H+ transporting lysosomal 42kDa V1 subunit C1 antibody
    • ATPase H+ transporting lysosomal V1 subunit C1 antibody
    • FLJ20057 antibody
    • H(+) transporting two sector ATPase subunit C antibody
    • H+ ATPase C subunit antibody
    • H+ transporting ATPase chain C vacuolar antibody
    • Subunit C of vacuolar proton ATPase V1 domain antibody
    • V ATPase C subunit antibody
    • V ATPase subunit C 1 antibody
    • V-ATPase subunit C 1 antibody
    • V-type proton ATPase subunit C 1 antibody
    • Vacuolar ATP synthase subunit C antibody
    • Vacuolar proton pump 42 kD subunit antibody
    • Vacuolar proton pump C subunit antibody
    • Vacuolar proton pump subunit C 1 antibody
    • Vacuolar protonATPase subunit C VI domain antibody
    • VATC antibody
    • VATC1_HUMAN antibody
    • VATPase C subunit antibody
    • VATPase subunit C 1 antibody
    • VMA5 antibody
    see all

Images

  • Anti-ATP6V1C1 antibody (ab194489) at 1/500 dilution + Human ovarian cancer tissue lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 44 kDa

References

ab194489 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194489.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up