Overview

  • Product name
    Anti-ATP6V1C2 antibody
  • Description
    Rabbit polyclonal to ATP6V1C2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment corresponding to Human ATP6V1C2 aa 2-195. (BC012142).
    Sequence:

    SEFWLISAPGDKENLQALERMNTVTSKSNLSYNTKFAIPDFKVGTLDSLV GLSDELGKLDTFAESLIRRMAQSVVEVMEDSKGKVQEHLLANGVDLTSFV THFEWDMAKYPVKQPLVSVVDTIAKQLAQIEMDLKSRTAAYNTLKTNLEN LEKKSMGNLFTRTLSDIVSKEDFVLDSEYLVTLLVIVPKPNYSQ


    Database link: Q8NEY4-2

  • Positive control
    • Human fetal kidney and mouse kidney lysates.

Properties

  • Form
    Lyophilised:Reconstitute in 200ul Sterile Distilled Water.
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab176771 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 44, 49 kDa.
IHC-P 1/100 - 1/500.

Target

  • Function
    Subunit of the peripheral V1 complex of vacuolar ATPase. Subunit C is necessary for the assembly of the catalytic sector of the enzyme and is likely to have a specific function in its catalytic activity. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
  • Tissue specificity
    Kidney and placenta.
  • Sequence similarities
    Belongs to the V-ATPase C subunit family.
  • Information by UniProt
  • Database links
  • Alternative names
    • ATP6C2 antibody
    • ATP6V1C2 antibody
    • ATPase H+ transporting lysosomal 42kDa V1 subunit C2 antibody
    • V ATPase C2 subunit antibody
    • V ATPase subunit C 2 antibody
    • V type proton ATPase subunit C 2 antibody
    • V-ATPase subunit C 2 antibody
    • V-type proton ATPase subunit C 2 antibody
    • Vacuolar ATP synthase subunit C 2 antibody
    • Vacuolar H+ ATPase C2 antibody
    • Vacuolar proton pump subunit C 2 antibody
    • VATC2_HUMAN antibody
    • VMA 5 antibody
    • VMA5 antibody
    see all

Images

  • All lanes : Anti-ATP6V1C2 antibody (ab176771) at 1/500 dilution

    Lane 1 : Human fetal kidney lysate
    Lane 2 : Mouse kidney lysate

    Predicted band size: 44, 49 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human fetal heart tissue labeling ATP6V1C2 with ab176771 at 1/100 dilution.

References

ab176771 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176771.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up