Overview

  • Product name

    Anti-ATP6V1G2 antibody
  • Description

    Rabbit polyclonal to ATP6V1G2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Dog, Pig, Chimpanzee, Rhesus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human ATP6V1G2 aa 2-118. (BC119726).
    Sequence:

    ASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRRER EHEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLG MVCDVRPQVHPNYRISA


    Database link: O95670

  • Positive control

    • HeLa, HepG2, A549, HT29, K562 cell lysates; Human brain tissue lysate.

Properties

  • Form

    Lyophilised:Reconstitute in 200 µl sterile water.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab199268 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 14 kDa.

Target

  • Function

    Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
  • Tissue specificity

    Brain.
  • Sequence similarities

    Belongs to the V-ATPase G subunit family.
  • Cellular localization

    Melanosome. Highly enriched in late-stage melanosomes.
  • Information by UniProt
  • Database links

  • Alternative names

    • ATP6G antibody
    • ATP6G2 antibody
    • ATP6V1G2 antibody
    • ATPase H+ transporting lysosomal (vacuolar proton pump) subunit G antibody
    • ATPase H+ transporting lysosomal 13kDa V1 subunit G2 antibody
    • H(+) transporting two sector ATPase subunit G2 antibody
    • NG 38 antibody
    • NG38 antibody
    • OTTHUMP00000036058 antibody
    • OTTHUMP00000036060 antibody
    • V ATPase 13 kDa subunit 2 antibody
    • V ATPase G subunit 2 antibody
    • V ATPase subunit G 2 antibody
    • V-ATPase 13 kDa subunit 2 antibody
    • V-ATPase subunit G 2 antibody
    • V-type proton ATPase subunit G 2 antibody
    • Vacuolar ATP synthase subunit G 2 antibody
    • Vacuolar proton pump G subunit 2 antibody
    • Vacuolar proton pump subunit G 2 antibody
    • VATG2_HUMAN antibody
    • VMA 10 antibody
    • VMA10 antibody
    see all

Images

  • All lanes : Anti-ATP6V1G2 antibody (ab199268) at 1/500 dilution

    Lane 1 : HeLa cell lysate
    Lane 2 : HepG2 cell lysate
    Lane 3 : A549 cell lysate
    Lane 4 : HT29 cell lysate
    Lane 5 : K562 cell lysate
    Lane 6 : Human brain tissue lysate

    Predicted band size: 14 kDa

References

ab199268 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab199268.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up