Overview

  • Product name

  • Description

    Rabbit polyclonal to ATP8B1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human ATP8B1 aa 217-330.
    Sequence:

    SSEPNSLCYVETAELDGETNLKFKMSLEITDQYLQREDTLATFDGFIECE EPNNRLDKFTGTLFWRNTSFPLDADKILLRGCVIRNTDFCHGLVIFAGAD TKIMKNSGKTRFKR


    Database link: O43520

  • Positive control

    • ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab234761 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.

Target

  • Function

    May play a role in the transport of aminophospholipids from the outer to the inner leaflet of various membranes and the maintenance of asymmetric distribution of phospholipids in the canicular membrane. May have a role in transport of bile acids into the canaliculus, uptake of bile acids from intestinal contents into intestinal mucosa or both.
  • Tissue specificity

    Found in most tissues except brain and skeletal muscle. Most abundant in pancreas and small intestine.
  • Involvement in disease

    Defects in ATP8B1 are the cause of progressive familial intrahepatic cholestasis type 1 (PFIC1) [MIM:211600]; also known as Byler disease. PFIC1 is an autosomal recessive disorder, characterized by early infancy cholestasis, that may be initially episodic but progresses to malnutrition, growth retardation and end-stage liver disease before adulthood.
    Defects in ATP8B1 are the cause of benign recurrent intrahepatic cholestasis type 1 (BRIC1) [MIM:243300]; also known as Summerskill syndrome. BRIC is characterized by intermittent episodes of cholestasis without progression to liver failure. There is initial elevation of serum bile acids, followed by cholestatic jaundice which generally spontaneously resolves after periods of weeks to months. The cholestatic attacks vary in severity and duration. Patients are asymptomatic between episodes, both clinically and biochemically.
    Defects in ATP8B1 can be associated with intrahepatic cholestasis of pregnancy (ICP) [MIM:147480]; also known as pregnancy-related cholestasis. ICP is a multifactorial liver disorder of pregnancy. It presents during the second or, more commonly, the third trimestre of pregnancy with intense pruritus which becomes more severe with advancing gestation and cholestasis. Cholestasis results from abnormal biliary transport from the liver into the small intestine. ICP causes fetal distress, spontaneous premature delivery and intrauterine death. ICP patients have spontaneous and progressive disappearance of cholestasis after delivery.
  • Sequence similarities

    Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IV subfamily.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • AT8B1_HUMAN antibody
    • ATP8B1 antibody
    • ATPase class I type 8B member 1 antibody
    • ATPase, aminophospholipid transporter, class I, type 8B, member 1 antibody
    • ATPIC antibody
    • BRIC antibody
    • E1-E2 ATPase antibody
    • Familial intrahepatic cholestasis type 1 antibody
    • FIC1 antibody
    • OTTHUMP00000163615 antibody
    • PFIC antibody
    • PFIC1 antibody
    • Phospholipid transporting ATPase IC antibody
    • Probable phospholipid-transporting ATPase IC antibody
    see all

Images

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for ATP8B1 (green) using ab234761 at 1/100 dilution in ICC/IF, followed by Alexa Fluor® 488 conjugated Goat Anti-Rabbit IgG (H+L).

References

ab234761 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234761.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up