Overview

  • Product name

    Anti-ATPase Inhibitory Factor 1/IF1 antibody
    See all ATPase Inhibitory Factor 1/IF1 primary antibodies
  • Description

    Rabbit polyclonal to ATPase Inhibitory Factor 1/IF1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human ATPase Inhibitory Factor 1/IF1 aa 17-103.
    Sequence:

    VRTMQARGFGSDQSENVDRGAGSIREAGGAFGKREQAEEERYFRAQSREQ LAALKKHHEEEIVHHKKEIERLQKEIERHKQKIKMLK


    Database link: Q9UII2

  • Positive control

    • WB: HEK-293T over-expression cell lysate. IHC-P: Human duodenum, rectum, kidney, testis, and fallopian tube tissue. ICC/IF: U-2 OS cells.
  • General notes

    Previously labelled as ATPase Inhibitory Factor 1. 

Properties

Applications

Our Abpromise guarantee covers the use of ab223779 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 12 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Endogenous F(1)F(o)-ATPase inhibitor limiting ATP depletion when the mitochondrial membrane potential falls below a threshold and the F(1)F(o)-ATP synthase starts hydrolyzing ATP to pump protons out of the mitochondrial matrix.
  • Sequence similarities

    Belongs to the ATPase inhibitor family.
  • Post-translational
    modifications

    Exhibits variability in chain length, mitochondria have distinct pools of protein cleaved after the 24th, 25th, and 26th amino acid.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • ATIF1_HUMAN antibody
    • ATP synthase inhibitor protein antibody
    • ATPase inhibitor antibody
    • ATPase inhibitor mitochondrial antibody
    • ATPase inhibitor protein antibody
    • ATPase inhibitory factor 1 antibody
    • ATPI antibody
    • ATPIF 1 antibody
    • Atpif1 antibody
    • ATPIP antibody
    • IF(1) antibody
    • IF1 antibody
    • Inhibitor of F(1)F(o)-ATPase antibody
    • IP antibody
    • MGC1167 antibody
    • MGC8898 antibody
    • mitochondrial antibody
    see all

Images

  • Paraffin-embedded human rectum tissue stained for ATPase Inhibitory Factor 1/IF1 using ab223779 at 1/50 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for ATPase Inhibitory Factor 1/IF1 (green) using ab223779 at 4 µg/ml in ICC/IF.

  • All lanes : Anti-ATPase Inhibitory Factor 1/IF1 antibody (ab223779) at 1/100 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate, vector only negative control
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) over-expressing C-terminally myc-DDK tagged ATPase Inhibitory Factor 1/IF1 cell lysate

    Predicted band size: 12 kDa

  • Paraffin-embedded human kidney tissue stained for ATPase Inhibitory Factor 1/IF1 using ab223779 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for ATPase Inhibitory Factor 1/IF1 using ab223779 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human fallopian tube tissue stained for ATPase Inhibitory Factor 1/IF1 using ab223779 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human duodenum tissue stained for ATPase Inhibitory Factor 1/IF1 using ab223779 at 1/50 dilution in immunohistochemical analysis.

References

ab223779 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223779.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up