Overview

  • Product name

    Anti-ATPase Inhibitory Factor 1/IF1 antibody
    See all ATPase Inhibitory Factor 1/IF1 primary antibodies
  • Description

    Rabbit polyclonal to ATPase Inhibitory Factor 1/IF1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISA, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to Human ATPase Inhibitory Factor 1/IF1 aa 38-87 (N terminal).
    Sequence:

    GSIREAGGAFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIER

  • Positive control

    • 293T cell lysate
  • General notes

    Previously labelled as ATPase Inhibitory Factor 1. 

Properties

Applications

Our Abpromise guarantee covers the use of ab81061 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 12 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent dilution.
ICC/IF Use at an assay dependent concentration. PubMed: 22684333

Target

  • Function

    Endogenous F(1)F(o)-ATPase inhibitor limiting ATP depletion when the mitochondrial membrane potential falls below a threshold and the F(1)F(o)-ATP synthase starts hydrolyzing ATP to pump protons out of the mitochondrial matrix.
  • Sequence similarities

    Belongs to the ATPase inhibitor family.
  • Post-translational
    modifications

    Exhibits variability in chain length, mitochondria have distinct pools of protein cleaved after the 24th, 25th, and 26th amino acid.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • ATIF1_HUMAN antibody
    • ATP synthase inhibitor protein antibody
    • ATPase inhibitor antibody
    • ATPase inhibitor mitochondrial antibody
    • ATPase inhibitor protein antibody
    • ATPase inhibitory factor 1 antibody
    • ATPI antibody
    • ATPIF 1 antibody
    • Atpif1 antibody
    • ATPIP antibody
    • IF(1) antibody
    • IF1 antibody
    • Inhibitor of F(1)F(o)-ATPase antibody
    • IP antibody
    • MGC1167 antibody
    • MGC8898 antibody
    • mitochondrial antibody
    see all

Images

  • Anti-ATPase Inhibitory Factor 1/IF1 antibody (ab81061) at 1 µg/ml (in 5% skim milk / PBS buffer) + 293T cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 12 kDa
    Observed band size: 10 kDa
    why is the actual band size different from the predicted?
    Additional bands at: 55 kDa. We are unsure as to the identity of these extra bands.

References

This product has been referenced in:

  • Capparelli C  et al. CTGF drives autophagy, glycolysis and senescence in cancer-associated fibroblasts via HIF1 activation, metabolically promoting tumor growth. Cell Cycle 11:2272-84 (2012). ICC/IF ; Human . Read more (PubMed: 22684333) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab81061.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up