Overview

  • Product name

  • Description

    Rabbit polyclonal to ATPBD3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human ATPBD3 aa 77-151.
    Sequence:

    RLGISLQLVAVDEGIGGYRDAALAAVRRQAARWELPLTVVAYEDLFGGWT MDAVARSTAGSGRSRSCCTFCGVLR


    Database link: Q7Z7A3

  • Positive control

    • Human kidney tissue, PC3 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab185473 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Directly binds tRNAs and probably acts by catalyzing adenylation of tRNAs, an intermediate required for 2-thiolation. It is unclear whether it acts as a sulfurtransferase that transfers sulfur from thiocarboxylated URM1 onto the uridine of tRNAs at wobble position.
  • Pathway

    tRNA modification; 5-methoxycarbonylmethyl-2-thiouridine-tRNA biosynthesis.
  • Sequence similarities

    Belongs to the TtcA family. CTU1/NCS6/ATPBD3 subfamily.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • ATP binding domain 3 antibody
    • ATP-binding domain-containing protein 3 antibody
    • Cancer associated protein antibody
    • Cancer-associated gene protein antibody
    • ctu1 antibody
    • CTU1_HUMAN antibody
    • Cytoplasmic tRNA 2-thiolation protein 1 antibody
    • Cytoplasmic tRNA adenylyltransferase 1 antibody
    • Cytosolic thiouridylase subunit 1 homolog antibody
    • NCS6 antibody
    see all

Images

  • Immunofluorescence analysis of Human PC3 cells labeling ATPBD3 with ab185473 at 4µg/ml.

  • Immunohistochemical analysis of paraffin embedded Human kidney tissue labeling ATPBD3 with ab185473 at a 1/200 dilution.

References

ab185473 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185473.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up