Overview

  • Product name

    Anti-ATRAP antibody [1G2]
    See all ATRAP primary antibodies
  • Description

    Mouse monoclonal [1G2] to ATRAP
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human ATRAP aa 108-159. (NP_065083).
    Sequence:

    HMYRERGGELLVHTGFLGSSQDRSAYQTIDSAEAPADPFAVPEGRSQDAR GY


    Database link: Q6RW13

  • Positive control

    • Human kidney tissue; HeLa nuclear extract; ATRAP transfected 293T cell lysate.
  • General notes

     This product was previously labelled as AGTRAP

     

Properties

Applications

Our Abpromise guarantee covers the use of ab219078 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 17 kDa.
IHC-P Use a concentration of 10 µg/ml. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.

Target

  • Information by UniProt
  • Database links

  • Alternative names

    • Agtrap antibody
    • Angiotensin II receptor associated protein antibody
    • Angiotensin II type I receptor associated protein antibody
    • AT1 receptor-associated protein antibody
    • ATI receptor associated protein antibody
    • ATRAP antibody
    • ATRAP_HUMAN antibody
    • MGC29646 antibody
    • OTTHUMP00000002269 antibody
    • OTTHUMP00000002270 antibody
    • OTTHUMP00000002271 antibody
    • Type 1 angiotensin II receptor associated protein antibody
    • Type-1 angiotensin II receptor-associated protein antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human kidney tissue labeling ATRAP with ab219078 at 10 µg/ml.

  • Anti-ATRAP antibody [1G2] (ab219078) at 1/500 dilution + HeLa nuclear extract

    Predicted band size: 17 kDa

  • All lanes : Anti-ATRAP antibody [1G2] (ab219078) at 1/500 dilution

    Lane 1 : ATRAP transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Predicted band size: 17 kDa

  • All lanes : Anti-ATRAP antibody [1G2] (ab219078) at 1/500 dilution

    Lane 1 : ATRAP over-expressed 293 cell lysate non-transfected control
    Lane 2 : ATRAP over-expressed 293 cell lysate cotransfected with AGTRAP validated chimera RNAi

    Predicted band size: 17 kDa



    GAPDH is shown as a loading control in the lower panel.

References

ab219078 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219078.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up