Overview

  • Product name

  • Description

    Rabbit polyclonal to ATXN2L
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human ATXN2L aa 456-547.
    Sequence:

    APISASCPEPPIGSAVPTSSASIPVTSSVSDPGVGSISPASPKISLAPTD VKELSTKEPGRTLEPQELARIAGKVPGLQNEQKRFQLEELRK


    Database link: Q8WWM7

  • Positive control

    • IHC-P: Human colon tissue. ICC/IF: A431 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab184834 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Tissue specificity

    Expressed at high levels in thymus, lymph node, spleen, fetal kidney and adult testis. Constitutively associated with MPL and EPOR in hematopoietic cells.
  • Sequence similarities

    Belongs to the ataxin-2 family.
  • Post-translational
    modifications

    Thrombopoietin triggers the phosphorylation on tyrosine residues in a way that is dependent on MPL C-terminal domain.
    Arg-361 is dimethylated, probably to asymmetric dimethylarginine.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • A2D antibody
    • A2LG antibody
    • A2LP antibody
    • A2RP antibody
    • Ataxin 2 domain protein antibody
    • Ataxin 2 like antibody
    • Ataxin 2 like protein antibody
    • Ataxin 2 related protein antibody
    • Ataxin-2 domain protein antibody
    • Ataxin-2 like antibody
    • Ataxin-2-like protein antibody
    • Ataxin-2-related protein antibody
    • ATX2L_HUMAN antibody
    • ATXN2L antibody
    • ATXN2L ataxin 2 like antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human colon tissue labeling ATXN2L with ab184834 at 1/200 dilution.

  • Immunofluorescent analysis of PFA/Triton X-100-treated A431 cells labeling ATXN2L with ab184834 at 4 µg/ml.

References

ab184834 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab184834.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up