Overview

  • Product name

    Anti-AVPR1B antibody - Cytoplasmic domain (HRP)
    See all AVPR1B primary antibodies
  • Description

    Rabbit polyclonal to AVPR1B - Cytoplasmic domain (HRP)
  • Host species

    Rabbit
  • Conjugation

    HRP
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Rat AVPR1B aa 343-425. Cytoplasmic domain.
    Sequence:

    NSRLLPRSLSHHACCTGSKPQVHRQLSTSSLTSRRTTLLTHACGSPTLRL SLNLSLRAKPRPAGSLKDLEQVDGEATMETSIF


    Database link: P48974

  • General notes

     This product was previously labelled as AVPR1B, Vasopressin V1b receptor

     

Properties

Applications

Our Abpromise guarantee covers the use of ab193423 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 47 kDa.

Target

  • Function

    Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger system.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family. Vasopressin/oxytocin receptor subfamily.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Antidiuretic hormone receptor 1b antibody
    • Antidiuretic hormone, receptor for, V1B antibody
    • Arginine vasopressin receptor 1B antibody
    • Arginine vasopressin receptor 3 antibody
    • AVPR V1b antibody
    • AVPR V3 antibody
    • Avpr1b antibody
    • AVPR3 antibody
    • Pituitary vasopressin receptor 3 antibody
    • V1bR antibody
    • V1BR_HUMAN antibody
    • Vasopressin V1b receptor antibody
    • Vasopressin V3 receptor antibody
    • VPR3 antibody
    see all

References

ab193423 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193423.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up