Overview

  • Product name

    Anti-AW-1 antibody
  • Description

    Rabbit polyclonal to AW-1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human AW-1 aa 57-199.
    Sequence:

    VSGPQEALSQLRQLCRQWLQPELHTKEQILELLVMEQFLTILPPEIQARV RHRCPMSSKEIVTLVEDFHRASKKPKQWVAVCMQGQKVLLEKTGSQLGEQ ELPDFQPQTPRRDLRESSPAEPSQAGAYDRLSPHHWEKSPLLQ


    Database link: Q15697

  • Positive control

    • WB: HEK-293T overexpressing AW-1 cell lysate. IHC-P: Human gallbladder tissue. ICC/IF: A431 cells.
  • General notes

    Previously labelled as ZNF174. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224356 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X100.

WB 1/100 - 1/250. Predicted molecular weight: 46 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Transcriptional repressor.
  • Tissue specificity

    Expressed in a variety of organs, but most strongly in adult testis and ovary followed by small intestine, colon, prostate, thymus, spleen, pancreas, skeletal muscle, heart, brain and kidney. Also expressed in umbilical vein endothelial cells, foreskin fibroblast and HEPG2 cells.
  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 3 C2H2-type zinc fingers.
    Contains 1 SCAN box domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • AW-1 antibody
    • AW1 antibody
    • Zinc finger and SCAN domain containing protein 8 antibody
    • Zinc finger and SCAN domain-containing protein 8 antibody
    • Zinc finger protein 174 antibody
    • ZN174_HUMAN antibody
    • ZNF174 antibody
    • ZSCAN8 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for AW-1 (green) using ab224356 at 4 µg/ml in ICC/IF.

  • All lanes : Anti-AW-1 antibody (ab224356) at 1/100 dilution

    Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) overexpressing AW-1 (co-expressed with a C-terminal myc-DDK tag), cell lysate

    Developed using the ECL technique.

    Predicted band size: 46 kDa

  • Paraffin-embedded human gallbladder tissue stained for AW-1 using ab224356 at 1/50 in immunohistochemical analysis.

References

ab224356 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224356.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up