Overview

  • Product name

  • Description

    Rabbit polyclonal to AWP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human AWP1 aa 1-208.
    Sequence:

    MAQETNHSQVPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISP PATSVSSLSESLPVQCTDGSVPEAQSALDSTSSSMQPSPVSNQSLLSESV ASSQLDSTSVDKAVPETEDVQASVSDTAQQPSEEQSKSLEKPKQKKNRCF MCRKKVGLTGFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVV VGEKIQKI


    Database link: Q6FIF0

  • Positive control

    • IHC-P: Human liver tissue. ICC/IF: A549 cells.
  • General notes

     This product was previously labelled as ZA20D3

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234698 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

Images

  • Paraffin-embedded human liver tissue stained for AWP1 using ab234698 at 1/100 dilution in immunohistochemical analysis.

  • A549 (human lung carcinoma cell line) cells stained for AWP1 (green) using ab234698 at 1/100 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-congugated Goat Anti-Rabbit IgG (H+L).

References

ab234698 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234698.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up