Overview

  • Product name

  • Description

    Rabbit polyclonal to AXUD1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human AXUD1 aa 128-197.
    Sequence:

    FAQEQARARHEKLRQRLKEEKLEMLQWKLSAAGVPQAEAGLPPVVDAIDD ASVEEDLAVAVAGGRLEEVS


    Database link: Q96S65

  • Positive control

    • U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220989 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Binds to the consensus sequence 5'-AGAGTG-3' and has transcriptional activator activity (By similarity). May have a tumor-suppressor function. May play a role in apoptosis.
  • Tissue specificity

    Ubiquitous. Most abundantly expressed in lung, placenta, skeletal muscle, pancreas and leukocyte. Frequently down-regulated in lung, kidney, liver and colon cancers compared with their corresponding normal tissues.
  • Sequence similarities

    Belongs to the AXUD1 family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 4931429D10Rik antibody
    • Axin 1 Up-regulated antibody
    • Axin-1 up-regulated gene 1 protein antibody
    • CSRN1_HUMAN antibody
    • CSRNP-1 antibody
    • CSRNP1 antibody
    • Cysteine/serine-rich nuclear protein 1 antibody
    • DKFZp566F164 antibody
    • FAM130B antibody
    • Protein URAX1 antibody
    • TAIP 3 antibody
    • TAIP-3 antibody
    • TGF beta induced apoptosis protein 3 antibody
    • TGF-beta-induced apoptosis protein 3 antibody
    • URAX1 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-2 OS cells labeling AXUD1 with ab220989 at 4 µg/ml (green).

References

ab220989 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220989.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up