Overview

  • Product name
  • Description
    Rabbit polyclonal to Azurocidin
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human Azurocidin aa 23-247. Expressed in E. coli. N-terminal tag.
    Sequence:

    PLLDIVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFQSQ NPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDLMLLQLD REANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNV TVTPEDQCRPNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPC GRGPDFFTRVALFRDWIDGVLNNPG


    Database link: P20160

  • Positive control
    • IHC-P: Human breast cancer, stomach cancer and bile duct cancer tissue. Human lung, liver and stomach tissue. WB: HEK-293T cell lysate; Human liver and rat spleen lysate; Recombinant human Azurocidin protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab231350 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml.

Target

  • Function
    This is a neutrophil granule-derived antibacterial and monocyte- and fibroblast-specific chemotactic glycoprotein. Binds heparin. The cytotoxic action is limited to many species of Gram-negative bacteria; this specificity may be explained by a strong affinity of the very basic N-terminal half for the negatively charged lipopolysaccharides that are unique to the Gram-negative bacterial outer envelope. It may play a role in mediating recruitment of monocytes in the second wave of inflammation. Has antibacterial activity against the Gram-nagative bacterium P.aeruginosa, this activity is inhibited by LPS from P.aeruginosa. Acting alone, it does not have antimicrobial activity against the Gram-negative bacteria A.actinomycetemcomitans ATCC 29532, A.actinomycetemcomitans NCTC 9709, A.actinomycetemcomitans FDC-Y4, H.aphrophilus ATCC 13252, E.corrodens ATCC 23834, C.sputigena ATCC 33123, Capnocytophaga sp ATCC 33124, Capnocytophaga sp ATCC 27872 or E.coli ML-35. Has antibacterial activity against C.sputigena ATCC 33123 when acting synergistically with either elastase or cathepsin G.
  • Sequence similarities
    Belongs to the peptidase S1 family. Elastase subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localization
    Cytoplasmic granule. Cytoplasmic granules of neutrophils.
  • Information by UniProt
  • Database links
  • Alternative names
    • Azu 1 antibody
    • AZU1 antibody
    • Azurocidin antibody
    • CAP37 antibody
    • CAP7_HUMAN antibody
    • Cationic antimicrobial protein 37 antibody
    • Cationic antimicrobial protein CAP37 antibody
    • HBP antibody
    • Heparin binding protein antibody
    • Heparin-binding protein antibody
    • HUMAZUR antibody
    • Neutrophil azurocidin antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human stomach cancer tissue stained for Azurocidin using ab231350 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Anti-Azurocidin antibody (ab231350) at 1 µg/ml + Rat spleen lysate

    Secondary
    HRP-linked Goat-Anti-Rabbit IgG polyclonal at 0.2 µg/ml
  • Anti-Azurocidin antibody (ab231350) at 1 µg/ml + Human liver lysate

    Secondary
    HRP-linked Goat Anti-Rabbit IgG polyclonal at 0.2 µg/ml
  • Anti-Azurocidin antibody (ab231350) at 2 µg/ml + HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate.
  • Formalin-fixed, paraffin-embedded human bile duct cancer tissue stained for Azurocidin using ab231350 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for Azurocidin using ab231350 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for Azurocidin using ab231350 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human lung tissue stained for Azurocidin using ab231350 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for Azurocidin using ab231350 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Anti-Azurocidin antibody (ab231350) at 2 µg/ml + Recombinant human Azurocidin protein

References

ab231350 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231350.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up