Overview

  • Product name

  • Description

    Rabbit polyclonal to B2R
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human B2R aa 336-391.
    Sequence:

    GKRFRKKSWEVYQGVCQKGGCRSEPIQMENSMGTLRTSISVERQIHKLQD WAGSRQ


    Database link: P30411

  • Positive control

    • WB: MCF7 whole cell lysate. IHC-P: Human brain tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236093 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 44 kDa.
IHC-P 1/100 - 1/300.

Target

  • Function

    Receptor for bradykinin. It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system.
  • Tissue specificity

    Ubiquitous. Widespread in normal smooth muscle tissue and neurons.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family. Bradikinin receptor subfamily. BDKRB2 sub-subfamily.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • B2 antibody
    • B2 bradykinin receptor antibody
    • B2BKR antibody
    • B2BRA antibody
    • B2R antibody
    • BDKR B2 antibody
    • BDKRB 2 antibody
    • BDKRB2 antibody
    • BK 2 antibody
    • BK 2 receptor antibody
    • BK R2 antibody
    • BK-2 receptor antibody
    • BK2 antibody
    • BK2 receptor antibody
    • BK2R antibody
    • BKR 2 antibody
    • BKR2 antibody
    • BKRB2_HUMAN antibody
    • BR B2 antibody
    • Bradykinin receptor B2 antibody
    • Bradykinin receptor beta 2 antibody
    • BRB 2 antibody
    • BRB2 antibody
    • DKFZp686O088 antibody
    • Kinin B2 antibody
    see all

Images

  • Anti-B2R antibody (ab236093) at 1/500 dilution + MCF7 (human breast adenocarcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 44 kDa

  • Paraffin-embedded human brain tissue stained for B2R using ab236093 at 1/300 dilution in immunohistochemical analysis. 

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

References

ab236093 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236093.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up