Anti-B3GALNT1 antibody (ab176891)
Key features and details
- Rabbit polyclonal to B3GALNT1
- Suitable for: IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-B3GALNT1 antibody -
Description
Rabbit polyclonal to B3GALNT1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human B3GALNT1 aa 45-233.
Sequence:ERVNWMYFYEYEPIYRQDFHFTLREHSNCSHQNPFLVILVTSHPSDVKAR QAIRVTWGEKKSWWGYEVLTFFLLGQEAEKEDKMLALSLEDEHLLYGDII RQDFLDTYNNLTLKTIMAFRWVTEFCPNAKYVMKTDTDVFINTGNLVKYL LNLNHSEKFFTGYPLIDNYSYRGFYQKTHISYQEYPFKV
Database link: BC047618 -
Positive control
- Rat muscle and mouse brain lysates. Human fetal colon tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Lyophilized:Reconstitute with 200ul distilled sterile water. Please note that if you receive this product in liquid form it has already been reconstituted as described and no further reconstitution is necessary. -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 98% PBS, 1% BSA -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab176891 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/100 - 1/500. | |
WB | 1/200 - 1/1000. Predicted molecular weight: 40 kDa. |
Target
-
Function
Transfers N-acetylgalactosamine onto globotriaosylceramide. -
Tissue specificity
Higher expression in heart and brain, and to a lesser extent in lung, placenta, kidney and testis. Lower expression in liver, spleen and stomach. No expression in skeletal muscle. -
Pathway
Protein modification; protein glycosylation. -
Sequence similarities
Belongs to the glycosyltransferase 31 family. -
Cellular localization
Golgi apparatus membrane. - Information by UniProt
-
Database links
- Entrez Gene: 8706 Human
- Entrez Gene: 26879 Mouse
- Entrez Gene: 310508 Rat
- Omim: 603094 Human
- SwissProt: O75752 Human
- SwissProt: Q920V1 Mouse
- SwissProt: Q6AY39 Rat
- Unigene: 418062 Human
see all -
Alternative names
- 3-galactosyltransferase 3 antibody
- 3-GalNAc-T1 antibody
- 3-GalTase 3 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-B3GALNT1 antibody (ab176891)
Immunohistochemical analysis of formalin fixed and paraffin embedded Human fetal colon labeling B3GALNT1 with ab176891 at 1/00 dilution.
-
All lanes : Anti-B3GALNT1 antibody (ab176891) at 1/200 dilution
Lane 1 : Rat muscle lysate
Lane 2 : Mouse brain lysate
Developed using the ECL technique.
Predicted band size: 40 kDa
Protocols
References (0)
ab176891 has not yet been referenced specifically in any publications.