Anti-B3GALNT1 antibody (ab176891)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-B3GALNT1 antibody -
Description
Rabbit polyclonal to B3GALNT1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat
-
Immunogen
Recombinant fragment corresponding to Human B3GALNT1 aa 45-233.
Sequence:ERVNWMYFYEYEPIYRQDFHFTLREHSNCSHQNPFLVILVTSHPSDVKAR QAIRVTWGEKKSWWGYEVLTFFLLGQEAEKEDKMLALSLEDEHLLYGDII RQDFLDTYNNLTLKTIMAFRWVTEFCPNAKYVMKTDTDVFINTGNLVKYL LNLNHSEKFFTGYPLIDNYSYRGFYQKTHISYQEYPFKV
Database link: BC047618 -
Positive control
- Rat muscle and mouse brain lysates. Human fetal colon tissue.
Properties
-
Form
Lyophilised:Reconstitute with 200ul distilled sterile water. Please note that if you receive this product in liquid form it has already been reconstituted as described and no further reconstitution is necessary. -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.02% Sodium azide
Constituents: 98% PBS, 1% BSA -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab176891 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/100 - 1/500. | |
| WB | 1/200 - 1/1000. Predicted molecular weight: 40 kDa. |
Target
-
Function
Transfers N-acetylgalactosamine onto globotriaosylceramide. -
Tissue specificity
Higher expression in heart and brain, and to a lesser extent in lung, placenta, kidney and testis. Lower expression in liver, spleen and stomach. No expression in skeletal muscle. -
Pathway
Protein modification; protein glycosylation. -
Sequence similarities
Belongs to the glycosyltransferase 31 family. -
Cellular localization
Golgi apparatus membrane. - Information by UniProt
-
Database links
- Entrez Gene: 8706 Human
- Entrez Gene: 26879 Mouse
- Entrez Gene: 310508 Rat
- Omim: 603094 Human
- SwissProt: O75752 Human
- SwissProt: Q920V1 Mouse
- SwissProt: Q6AY39 Rat
- Unigene: 418062 Human
see all -
Alternative names
- 3-galactosyltransferase 3 antibody
- 3-GalNAc-T1 antibody
- 3-GalTase 3 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-B3GALNT1 antibody (ab176891)Immunohistochemical analysis of formalin fixed and paraffin embedded Human fetal colon labeling B3GALNT1 with ab176891 at 1/00 dilution.
-
Western blot - Anti-B3GALNT1 antibody (ab176891)All lanes : Anti-B3GALNT1 antibody (ab176891) at 1/200 dilution
Lane 1 : Rat muscle lysate
Lane 2 : Mouse brain lysate
Developed using the ECL technique.
Predicted band size: 40 kDa
References
ab176891 has not yet been referenced specifically in any publications.
