Overview

  • Product name

  • Description

    Rabbit polyclonal to B3GALT4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human B3GALT4 aa 42-266.
    Sequence:

    PAPASPGPPLALPRLLIPNQEACSGPGAPPFLLILVCTAPENLNQRNAIR ASWGGLREARGLRVQTLFLLGEPNAQHPVWGSQGSDLASESAAQGDILQA AFQDSYRNLTLKTLSGLNWAEKHCPMARYVLKTDDDVYVNVPELVSELVL RGGRWGQWERSTEPQREAEQEGGQVLHSEEVPLLYLGRVHWRVNPSRTPG GRHRVSEEQWPHTWGPFPPYASGTG


    Database link: O96024

  • Positive control

    • WB: U-87 MG and A549 whole cell lysates; Mouse skeletal muscle tissue lysate. IHC-P: Human lung cancer and skeletal muscle tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab224630 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Detects a band of approximately 42 kDa (predicted molecular weight: 42 kDa).

Target

  • Function

    Involved in GM1/GD1B/GA1 ganglioside biosynthesis.
  • Tissue specificity

    Highly expressed in heart, skeletal muscle and pancreas and, to a lesser extent, in brain, placenta, kidney, liver and lung.
  • Pathway

    Protein modification; protein glycosylation.
  • Sequence similarities

    Belongs to the glycosyltransferase 31 family.
  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 3-galactosyltransferase 4 antibody
    • 3-galactosyltransferase antibody
    • 3-GalTase 4 antibody
    • b3Gal-T4 antibody
    • B3GALT4 antibody
    • B3GT4_HUMAN antibody
    • Beta 1,3 galactosyltransferase 4 antibody
    • Beta 1,3 GalTase 4 antibody
    • Beta 3 galactosyltransferase 4 antibody
    • Beta-1 antibody
    • Beta3Gal-T4 antibody
    • Beta3GalT4 antibody
    • Gal T2 antibody
    • GAL-T2 antibody
    • GALT2 antibody
    • GalT4 antibody
    • Ganglioside galactosyltransferase antibody
    • OTTHUMP00000029128 antibody
    • UDP Gal:betaGlcNAc beta 1,3 galactosyltransferase, polypeptide 4 antibody
    • UDP galactose:beta N acetyl galactosamine beta 1,3 galactosyltransferase antibody
    • UDP-galactose:beta-N-acetyl-galactosamine-beta-1 antibody
    see all

Images

  • All lanes : Anti-B3GALT4 antibody (ab224630) at 1/500 dilution

    Lane 1 : U-87 MG (human glioblastoma-astrocytoma epithelial cell line) whole cell lysate
    Lane 2 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 3 : Mouse skeletal muscle tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 42 kDa
    Observed band size: 42 kDa

  • Paraffin-embedded human lung cancer tissue stained for B3GALT4 using ab224630 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human skeletal muscle tissue stained for B3GALT4 using ab224630 at 1/100 dilution in immunohistochemical analysis.

References

ab224630 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224630.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up