Anti-B3GAT1 antibody (ab221756)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-B3GAT1 antibody
See all B3GAT1 primary antibodies -
Description
Rabbit polyclonal to B3GAT1 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Chimpanzee
-
Immunogen
Recombinant fragment corresponding to Human B3GAT1 aa 32-86.
Sequence:LLAVHKDEGSDPRRETPPGADPREYCTSDRDIVEVVRTEYVYTRPPPWSD TLPTI
Database link: Q9P2W7 -
Positive control
- ICC/IF: SH-SY5Y cells.
-
General notes
Previously labeled as CD57.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab221756 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Function
Involved in the biosynthesis of L2/HNK-1 carbohydrate epitope on glycoproteins. Can also play a role in glycosaminoglycan biosynthesis. Substrates include asialo-orosomucoid (ASOR), asialo-fetuin, and asialo-neural cell adhesion molecule. Requires sphingomyelin for activity: stearoyl-sphingomyelin was the most effective, followed by palmitoyl-sphingomyelin and lignoceroyl-sphingomyelin. Activity was demonstrated only for sphingomyelin with a saturated fatty acid and not for that with an unsaturated fatty acid, regardless of the length of the acyl group. -
Tissue specificity
Mainly expressed in the brain. -
Pathway
Protein modification; protein glycosylation. -
Sequence similarities
Belongs to the glycosyltransferase 43 family. -
Cellular localization
Golgi apparatus membrane. - Information by UniProt
-
Database links
- Entrez Gene: 466859 Chimpanzee
- Entrez Gene: 27087 Human
- Entrez Gene: 76898 Mouse
- Entrez Gene: 117108 Rat
- Omim: 151290 Human
- SwissProt: Q5CB04 Chimpanzee
- SwissProt: Q9P2W7 Human
- SwissProt: Q9CW73 Mouse
see all -
Alternative names
- 3-glucuronyltransferase 1 antibody
- 3-glucuronyltransferase antibody
- B3GA1_HUMAN antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-B3GAT1 antibody (ab221756)PFA-fixed, Triton X-100 permeabilized SH-SY5Y (human neuroblastoma cell line from bone marrow) cells stained for B3GAT1 (green) using ab221756 at 4 µg/ml in ICC/IF.
Datasheets and documents
References
ab221756 has not yet been referenced specifically in any publications.
