Overview

  • Product name

  • Description

    Rabbit polyclonal to b4Gal-T6
  • Host species

    Rabbit
  • Specificity

    ab200639 detects endogenous levels of b4Gal-T6.
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human b4Gal-T6 aa 326-371. The exact sequence is proprietary.
    Sequence:

    RGEVQFLGRYKLLRYSKERQYIDGLNNLIYRPKILVDRLYTNISVN


    Database link: Q9UBX8

  • Positive control

    • HEK293T, A549 and mouse sp2/0 cell lysates.
  • General notes

    Previously labelled as Beta-1, 4-galactosyltransferase 6.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.097% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab200639 was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen and the purity is >95% (by SDS-PAGE).
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab200639 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 45 kDa.

Target

  • Function

    Required for the biosynthesis of glycosphingolipids.
  • Tissue specificity

    High expression in brain and adrenal gland, lower in liver, lung, colon and peripheral white blood cells.
  • Pathway

    Protein modification; protein glycosylation.
  • Sequence similarities

    Belongs to the glycosyltransferase 7 family.
  • Cellular localization

    Golgi apparatus > Golgi stack membrane. Trans cisternae of Golgi stack.
  • Information by UniProt
  • Database links

  • Alternative names

    • 4-galactosyltransferase 6 antibody
    • 4-galactosyltransferase antibody
    • 4-GalTase 6 antibody
    • AA536803 antibody
    • AU022389 antibody
    • b4Gal-T6 antibody
    • B4galt6 antibody
    • B4GT6_HUMAN antibody
    • Beta-1 antibody
    • beta-1,4-galactosyltransferase 6 antibody
    • beta-1,4-GalTase 6 antibody
    • Beta4Gal-T6 antibody
    • beta4GalT-VI antibody
    • LacCer synthase antibody
    • Lactosylceramide synthase antibody
    • UDP-Gal:beta-GlcNAc beta-1 antibody
    • UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 6 antibody
    • UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6 antibody
    • UDP-Gal:glucosylceramide beta-1 antibody
    • UDP-Gal:glucosylceramide beta-1,4-galactosyltransferase antibody
    • UDP-galactose:beta-N-acetylglucosamine beta-1 antibody
    • UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 6 antibody
    see all

Images

  • All lanes : Anti-b4Gal-T6 antibody (ab200639)

    Lane 1 : HEK293T whole cell lysate
    Lane 2 : A549 whole cell lysate
    Lane 3 : mouse sp/0 whole cell lysate

    Predicted band size: 45 kDa

References

ab200639 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200639.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up