Overview

  • Product name

  • Description

    Rabbit polyclonal to b4Gal-T6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human b4Gal-T6 aa 93-157.
    Sequence:

    TTYLPENFTYSPYLPCPEKLPYMRGFLNVNVSEVSFDEIHQLFSKDLDIE PGGHWRPKDCKPRWK


    Database link: Q9UBX8

  • Positive control

    • Human adrenal gland tissue.
  • General notes

    Previously labelled as Beta-1, 4-galactosyltransferase 6.

Properties

Applications

Our Abpromise guarantee covers the use of ab204593 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Required for the biosynthesis of glycosphingolipids.
  • Tissue specificity

    High expression in brain and adrenal gland, lower in liver, lung, colon and peripheral white blood cells.
  • Pathway

    Protein modification; protein glycosylation.
  • Sequence similarities

    Belongs to the glycosyltransferase 7 family.
  • Cellular localization

    Golgi apparatus > Golgi stack membrane. Trans cisternae of Golgi stack.
  • Information by UniProt
  • Database links

  • Alternative names

    • 4-galactosyltransferase 6 antibody
    • 4-galactosyltransferase antibody
    • 4-GalTase 6 antibody
    • AA536803 antibody
    • AU022389 antibody
    • b4Gal-T6 antibody
    • B4galt6 antibody
    • B4GT6_HUMAN antibody
    • Beta-1 antibody
    • beta-1,4-galactosyltransferase 6 antibody
    • beta-1,4-GalTase 6 antibody
    • Beta4Gal-T6 antibody
    • beta4GalT-VI antibody
    • LacCer synthase antibody
    • Lactosylceramide synthase antibody
    • UDP-Gal:beta-GlcNAc beta-1 antibody
    • UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 6 antibody
    • UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6 antibody
    • UDP-Gal:glucosylceramide beta-1 antibody
    • UDP-Gal:glucosylceramide beta-1,4-galactosyltransferase antibody
    • UDP-galactose:beta-N-acetylglucosamine beta-1 antibody
    • UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 6 antibody
    see all

Images

  • Immunohistochemical analysis of Paraffin-embedded Human adrenal tissue labeling b4Gal-T6 with ab204593 at 1/20 dilution. 

References

ab204593 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204593.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up