Overview

  • Product name

    Anti-B4GALT2 antibody
  • Description

    Rabbit polyclonal to B4GALT2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human B4GALT2 aa 271-372.
    Sequence:

    FPNEYWGWGGEDDDIFNRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPN PQRFTKIQNTKLTMKRDGIGSVRYQVLEVSRQPLFTNITVDIGRPPSWPP RG


    Database link: O60909

  • Positive control

    • WB: A549, HepG2 and U-251 whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab234707 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 42 kDa (predicted molecular weight: 42 kDa).

Target

  • Function

    Responsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids. Can produce lactose.
  • Tissue specificity

    Weakly expressed in various tissues. Highest expression in prostate, testis, ovary, intestine, muscle, and in fetal brain.
  • Pathway

    Protein modification; protein glycosylation.
  • Sequence similarities

    Belongs to the glycosyltransferase 7 family.
  • Cellular localization

    Golgi apparatus > Golgi stack membrane. Trans cisternae of Golgi stack.
  • Information by UniProt
  • Database links

  • Alternative names

    • 4-galactosyltransferase 2 antibody
    • 4-galactosyltransferase antibody
    • 4-GalTase 2 antibody
    • B4Gal T2 antibody
    • b4Gal-T2 antibody
    • B4GALT2 antibody
    • B4GT2_HUMAN antibody
    • Beta 1,4 galactosyltransferase 2 antibody
    • Beta 1,4 GalTase 2 antibody
    • Beta 4 GalT2 antibody
    • Beta N acetylglucosaminyl glycolipid beta 1,4 galactosyltransferase 2 antibody
    • Beta-1 antibody
    • Beta-N-acetylglucosaminyl-glycolipid beta-1 antibody
    • Beta4Gal T2 antibody
    • Beta4Gal-T2 antibody
    • Nal synthase antibody
    • UDP Gal:beta GlcNAc beta 1,4 galactosyltransferase 2 antibody
    • UDP Gal:betaGlcNAc beta 1,4 galactosyltransferase polypeptide 2 antibody
    • UDP galactose:beta N acetylglucosamine beta 1,4 galactosyltransferase 2 antibody
    • UDP-Gal:beta-GlcNAc beta-1 antibody
    • UDP-galactose:beta-N-acetylglucosamine beta-1 antibody
    see all

Images

  • All lanes : Anti-B4GALT2 antibody (ab234707) at 1/500 dilution

    Lane 1 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 3 : U-251 (human brain glioma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 42 kDa
    Observed band size: 42 kDa

References

ab234707 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234707.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up