Overview

  • Product name

  • Description

    Rabbit polyclonal to B7-H6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human B7-H6 aa 25-262.
    Sequence:

    DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDK EVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEV VVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAIN ITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGT VYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFS


    Database link: Q68D85

  • Positive control

    • WB: Mouse heart, liver and brain tissue lysates; HeLa whole cell lysate (ab150035). IHC-P: Human melanoma tissue. ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab229999 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 51 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Triggers NCR3-dependent natural killer cell activation.
  • Tissue specificity

    Not detected in any normal tissue tested. Expressed at the surface of several tumor cell lines including T and B lymphomas, myeloid leukemias, melanomas, carcinomas and large T SV40 antigen-transformed cells (at protein level).
  • Sequence similarities

    Contains 1 Ig-like C1-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Domain

    The C-terminal part is similar to retroviral Gag protein. This putative protein seems to be the result of a fusion between an Ig-like domain-containing protein and a ERV.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • B7 homolog 6 antibody
    • B7-H6 antibody
    • B7H6 antibody
    • B7H6_HUMAN antibody
    • DKFZp686O24166 antibody
    • Natural cytotoxicity triggering receptor 3 ligand 1 antibody
    • NCR3LG1 antibody
    • Putative Ig like domain containing protein DKFZp686O24166/DKFZp686I21167 antibody
    see all

Images

  • All lanes : Anti-B7-H6 antibody (ab229999) at 1/1000 dilution

    Lane 1 : Mouse heart tissue lysate
    Lane 2 : Mouse liver tissue lysate
    Lane 3 : Mouse brain tissue lysate
    Lane 4 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 51 kDa
    Observed band size: 32,38,51 kDa
    why is the actual band size different from the predicted?

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for B7-H6 (green) using ab229999 at 1/100 dilution in ICC/IF, followed by Alexa Fluor® 488-conjugated Goat Anti-Rabbit IgG(H+L) as the secondary antibody.

  • Paraffin-embedded human melanoma tissue stained for B7-H6 using ab229999 at 1/100 dilution in immunohistochemical analysis.

References

ab229999 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229999.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up