Overview

  • Product name

  • Description

    Rabbit polyclonal to BAAT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human BAAT aa 313-400.
    Sequence:

    IEEAQGQFLFIVGEGDKTINSKAHAEQAIGQLKRHGKNNWTLLSYPGAGH LIEPPYSPLCCASTTHDLRLHWGGEVIPHAAAQEHAWK


    Database link: Q14032

  • Positive control

    • IHC-P: Human liver cancer tissue. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab234803 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Function

    Involved in bile acid metabolism. In liver hepatocytes catalyzes the second step in the conjugation of C24 bile acids (choloneates) to glycine and taurine before excretion into bile canaliculi. The major components of bile are cholic acid and chenodeoxycholic acid. In a first step the bile acids are converted to an acyl-CoA thioester, either in peroxisomes (primary bile acids deriving from the cholesterol pathway), or cytoplasmic at the endoplasmic reticulum (secondary bile acids). May catalyze the conjugation of primary or secondary bile acids, or both. The conjugation increases the detergent properties of bile acids in the intestine, which facilitates lipid and fat-soluble vitamin absorption. In turn, bile acids are deconjugated by bacteria in the intestine and are recycled back to the liver for reconjugation (secondary bile acids). May also act as an acyl-CoA thioesterase that regulates intracellular levels of free fatty acids. In vitro, catalyzes the hydrolysis of long- and very long-chain saturated acyl-CoAs to the free fatty acid and coenzyme A (CoASH), and conjugates glycine to these acyl-CoAs.
  • Tissue specificity

    Expressed in liver, gallbladder mucosa and pancreas.
  • Involvement in disease

    Defects in BAAT are involved in familial hypercholanemia (FHCA) [MIM:607748]. FHCA is a disorder characterized by elevated serum bile acid concentrations, itching, and fat malabsorption.
  • Sequence similarities

    Belongs to the C/M/P thioester hydrolase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ20300 antibody
    • BAAT antibody
    • BAAT_HUMAN antibody
    • BACAT antibody
    • BAT antibody
    • Bile acid CoA: amino acid N-acyltransferase (glycine N-choloyltransferase) antibody
    • Bile acid CoA:amino acid N acyltransferase antibody
    • Bile acid Coenzyme A amino acid N acyltransferase glycine N choloyltransferase antibody
    • Bile acid Coenzyme A: amino acid N acyltransferase antibody
    • Bile acid-CoA:amino acid N-acyltransferase antibody
    • Glycine N choloyltransferase antibody
    • Glycine N-choloyltransferase antibody
    • Long chain fatty acyl CoA hydrolase antibody
    • Long-chain fatty-acyl-CoA hydrolase antibody
    • MGC104432 antibody
    see all

Images

  • Paraffin-embedded human liver cancer tissue stained for BAAT using ab234803 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for BAAT (green) using ab234803 at 1/100 dilution in ICC/IF, followed by Alexa Fluor® 488 conjugated Goat Anti-Rabbit IgG (H+L).

References

ab234803 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234803.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up