Overview

  • Product name

  • Description

    Rabbit polyclonal to BACH2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human BACH2 aa 263-349.
    Sequence:

    SNSLKPGLARGQIKSEPPSEENEEESITLCLSGDEPDAKDRAGDVEMDRK QPSPAPTPTAPAGAACLERSRSVASPSCLRSLFSITK


    Database link: Q9BYV9

  • Positive control

    • SH-SY5Y cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220988 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Transcriptional regulator that acts as repressor or activator. Binds to Maf recognition elements (MARE). Play important roles in coordinating transcription activation and repression by MAFK.
  • Tissue specificity

    B-cell specific.
  • Sequence similarities

    Belongs to the bZIP family. CNC subfamily.
    Contains 1 BTB (POZ) domain.
    Contains 1 bZIP domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Bach 2 antibody
    • Bach2 antibody
    • BACH2_HUMAN antibody
    • Basic leucine zipper transcription factor 2 antibody
    • BTB and CNC homolog 2 antibody
    • BTB and CNC homology 1 basic leucine zipper transcription factor 2 antibody
    • BTB domain and CNC homolog 2 antibody
    • BTBD25 antibody
    • OTTHUMP00000016867 antibody
    • OTTHUMP00000016868 antibody
    • OTTHUMP00000040591 antibody
    • Transcription regulator protein BACH2 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized SH-SY5Y cells labeling BACH2 with ab220988 at 4 µg/ml (green).

References

ab220988 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220988.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up