Overview

  • Product name

    Anti-BAF-L antibody
  • Description

    Rabbit polyclonal to BAF-L
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human BAF-L aa 11-87.
    Sequence:

    FLSEPIGEKDVCWVDGISHELAINLVTKGINKAYILLGQFLLMHKNEAEF QRWLICCFGATECEAQQTSHCLKEWCA

  • Positive control

    • Human pancreas tissue.
  • General notes

    Previously labelled as BANF2.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab122806 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use at an assay dependent concentration.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

  • Function

    May play a role in BANF1 regulation and influence tissue-specific roles of BANF1.
  • Tissue specificity

    Expressed strongly in testis and pancreas. Also detected in brain, colon, liver, lung, ovary, placenta, prostate, small intestine, spleen and thymus. Not detected in heart, kidney and skeletal muscle.
  • Sequence similarities

    Belongs to the BAF family.
  • Cellular localization

    Nucleus. Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • BAF-L antibody
    • BAF2 antibody
    • BAFL antibody
    • BAFL_HUMAN antibody
    • BANF2 antibody
    • Barrier-to-autointegration factor 2 antibody
    • Barrier-to-autointegration factor-like protein antibody
    • C20orf179 antibody
    see all

Images

  • All lanes : Anti-BAF-L antibody (ab122806)

    Lane 1 : Negative control (vector only transfected HEK293T lysate)
    Lane 2 : Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells.
  • ab122806, at 1/50 dilution, staining BAF-L in paraffin-embedded Human pancreas tissue by Immunohistochemistry.

  • Immunofluorescent staining of Human cell line A-431 shows positivity in nucleus but not nucleoli using ab122806.
    Recommended treatment:
    Fixation/Permeabilization: PFA/Triton X-100

References

ab122806 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab122806.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up