Overview

  • Product name

    Anti-Baf180 antibody [CL0331]
    See all Baf180 primary antibodies
  • Description

    Mouse monoclonal [CL0331] to Baf180
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Mouse Baf180 aa 102-247.
    Sequence:

    KMEEYDDVNLLTADFQLLFNNAKSYYKPDSPEYKAACKLWDLYLRTRNEF VQKGEADDEDDDEDGQDNQGTVTEGSSPAYLKEILEQLLEAIVVATNPSG RLISELFQKLPSKVQYPDYYAIIKEPIDLKTIAQRIQNGSYKSIHA


    Database link: Q86U86

  • Positive control

    • IHC-P: Human endometrium, kidney and breast cancer tissue. WB: Human RT-4 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab242318 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Act as a negative regulator of cell proliferation.
  • Tissue specificity

    Widely expressed.
  • Involvement in disease

    Defects in PBRM1 are a cause of renal cell carcinoma (RCC) [MIM:144700]. It is a heterogeneous group of sporadic or hereditary carcinoma derived from cells of the proximal renal tubular epithelium. It is subclassified into clear cell renal carcinoma (non-papillary carcinoma), papillary renal cell carcinoma, chromophobe renal cell carcinoma, collecting duct carcinoma with medullary carcinoma of the kidney, and unclassified renal cell carcinoma.
  • Sequence similarities

    Contains 2 BAH domains.
    Contains 6 bromo domains.
    Contains 1 HMG box DNA-binding domain.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • BAF180 antibody
    • BRG1-associated factor 180 antibody
    • CG11375 antibody
    • hPB1 antibody
    • MGC156155 antibody
    • MGC156156 antibody
    • OTTHUMP00000202149 antibody
    • OTTHUMP00000202150 antibody
    • OTTHUMP00000202151 antibody
    • OTTHUMP00000202153 antibody
    • OTTHUMP00000202163 antibody
    • PB1 antibody
    • PB1_HUMAN antibody
    • Pbrm1 antibody
    • polybromo 1 antibody
    • Polybromo-1D antibody
    • Protein polybromo-1 antibody
    see all

Images

  • Paraffin-embedded human endometrium tissue stained for Baf180 using ab242318 at 1/50 dilution in immunohistochemical analysis. 

  • All lanes : Anti-Baf180 antibody [CL0331] (ab242318) at 1 µg/ml

    Lane 1 : RT-4 cells transfected with control siRNA
    Lane 2 : RT-4 cells transfected with target specific siRNA probe
  • Paraffin-embedded human breast cancer tissue stained for Baf180 using ab242318 at 1/50 dilution in immunohistochemical analysis. 

  • Negative Control:

    Paraffin-embedded human skeletal muscle tissue stained for Baf180 using ab242318 at 1/50 dilution in immunohistochemical analysis. 

  • Anti-Baf180 antibody [CL0331] (ab242318) at 1 µg/ml + Human RT-4 whole cell lysate
  • Paraffin-embedded human kidney cancer tissue stained for Baf180 using ab242318 at 1/50 dilution in immunohistochemical analysis. 

References

ab242318 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab242318.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up