
  • Product name

    Anti-BAF53A antibody [N336B/83]
    See all BAF53A primary antibodies
  • Description

    Mouse monoclonal [N336B/83] to BAF53A
  • Host species

  • Specificity

    >50% identity with BAF53a. Does not cross-react with BAF53b.
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Fusion protein corresponding to BAF53A. Fusion protein amino acids 43-119 (MVVERDDGSTLMEIDGDKGKQGGPTYYIDTNALRVPRENME AISPLK NGMVEDWDSFQAILDHTYKMHVKSEASLHP, actin subdomain 2) of human BAF53a.

  • Positive control

    • This antibody gave a positive signal in rat testis tissue lysate, and in the following whole cell lysates: HeLa; Jurkat; NIH3T3; PC12.
  • General notes

    This antibody clone is manufactured by Abcam.

    If you require this antibody in a particular buffer formulation or a particular conjugate for your experiments, please contact orders@abcam.com or you can find further information here.



Our Abpromise guarantee covers the use of ab174941 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 47 kDa (predicted molecular weight: 47 kDa).


  • Relevance

    This protein is a family member of actin-related proteins (ARPs), which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This protein is a 53 kDa subunit of the BAF (BRG1/brm-associated factor) complex in mammals, which is functionally related to SWI/SNF complex in S. cerevisiae and Drosophila; the latter is thought to facilitate transcriptional activation of specific genes by antagonizing chromatin-mediated transcriptional repression. Together with beta-actin, it is required for maximal ATPase activity of BRG1, and for the association of the BAF complex with chromatin/matrix. It is required for maximal ATPase activity of SMARCA4/BRG1 and for association of the SMARCA4/BRG1 containing remodelling complex BAF with chromatin/nuclear matrix. It is a component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage.
  • Cellular localization

  • Database links

  • Alternative names

    • 53 kDa BRG1 associated factor A antibody
    • Actin like 6A antibody
    • Actin like protein 6A antibody
    • Actin related protein antibody
    • Actin related protein Baf53a antibody
    • actin-related protein 4 antibody
    • ACTL 6 antibody
    • ACTL 6A antibody
    • ACTL6 antibody
    • ACTL6A antibody
    • Arp4 antibody
    • ARPN BETA antibody
    • ArpNbeta antibody
    • BAF 53 antibody
    • BAF 53A antibody
    • BAF complex 53 kDa subunit antibody
    • BAF53 antibody
    • BRG1 associated factor 53A antibody
    • BRG1 associated factor antibody
    • BRG1/brm associated factor 53A antibody
    • hArpN beta antibody
    • INO80 complex subunit K antibody
    • INO80K antibody
    • MGC5382 antibody
    see all


  • All lanes : Anti-BAF53A antibody [N336B/83] (ab174941) at 1 µg/ml

    Lane 1 : HeLa (Human epithelial carcinoma cell line) Whole Cell Lysate
    Lane 2 : Jurkat (Human T cell lymphoblast-like cell line) Whole Cell Lysate
    Lane 3 : NIH 3T3 (Mouse embryonic fibroblast cell line) Whole Cell Lysate
    Lane 4 : PC12 (Rat adrenal pheochromocytoma cell line) Whole Cell Lysate
    Lane 5 : Testis (Rat) Tissue Lysate - normal tissue (ab29388)

    Lysates/proteins at 20 µg per lane.

    All lanes : Goat Anti-Mouse IgG H&L (HRP) preadsorbed (ab97040) at 1/10000 dilution

    Performed under reducing conditions.

    Predicted band size: 47 kDa
    Observed band size: 47 kDa

    Exposure time: 8 minutes


ab174941 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174941.
Please use the links above to contact us or submit feedback about this product.

For licensing inquiries, please contact partnerships@abcam.com

Sign up