Overview

  • Product name

  • Description

    Rabbit polyclonal to BAF60C
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human BAF60C aa 4-55.
    Sequence:

    DEVAGGARKATKSKLFEFLVHGVRPGMPSGARMPHQGAPMGPPGSPYMGS PA


    Database link: Q6STE5

  • Positive control

    • SH-SY5Y cells; Human heart muscle tissue.
  • General notes

    Previously labelled as SMARCD3. 

Applications

Our Abpromise guarantee covers the use of ab204745 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Plays a role in ATP dependent nucleosome remodeling by SMARCA4 containing complexes. Stimulates nuclear receptor mediated transcription. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth.
  • Tissue specificity

    Isoform 2 and isoform 1 are expressed in brain, heart, kidney, placenta, prostate, salivary gland, spleen, testis, thyroid, trachea and uterus. Isoform 1 is also expressed in skeletal muscle and adipose tissue.
  • Sequence similarities

    Belongs to the SMARCD family.
    Contains 1 SWIB domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 60 kDa BRG 1/Brm associated factor subunit C antibody
    • 60 kDa BRG-1/Brm-associated factor subunit C antibody
    • BAF60C antibody
    • BRG1 associated factor 60C antibody
    • BRG1-associated factor 60C antibody
    • Chromatin remodeling complex BAF60C subunit antibody
    • CRACD3 antibody
    • Mammalian chromatin remodeling complex BRG1 associated factor 60C antibody
    • MGC111010 antibody
    • Rsc6p antibody
    • Smarcd3 antibody
    • SMRD3_HUMAN antibody
    • SWI/SNF complex 60 kDa subunit C antibody
    • SWI/SNF related matrix associated actin dependent regulator of chromatin subfamily d member 3 antibody
    • SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3, isoform 1 antibody
    • SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3 antibody
    • Swp73 like protein antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized SH-SY5Y cells labeling BAF60C with ab204745 at 4 µg/ml (green).

  • Immunohistochemical analysis of paraffin-embedded Human heart muscle tissue labeling BAF60C with ab204745 at 1/500 dilution.

References

ab204745 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204745.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up