Overview

  • Product name

  • Description

    Rabbit polyclonal to BAFF
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Mouse BAFF aa 270-309 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    YSAGIARLEEGDEIQLAIPRENAQISRNGDDTFFGALKLL


    Database link: Q9WU72

  • Positive control

    • Human nasopharyngeal carcinoma and rat liver tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab217329 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

When using a fluorescent secondary antibody the recommended dilution is 1/50 – 1/200.

Target

  • Function

    Cytokine that binds to TNFRSF13B/TACI and TNFRSF17/BCMA. TNFSF13/APRIL binds to the same 2 receptors. Together, they form a 2 ligands -2 receptors pathway involved in the stimulation of B-and T-cell function and the regulation of humoral immunity. A third B-cell specific BAFF-receptor (BAFFR/BR3) promotes the survival of mature B-cells and the B-cell response.
  • Tissue specificity

    Abundantly expressed in peripheral blood Leukocytes and is specifically expressed in monocytes and macrophages. Also found in the spleen, lymph node, bone marrow, T-cells and dendritic cells. A lower expression seen in placenta, heart, lung, fetal liver, thymus, and pancreas.
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
  • Post-translational
    modifications

    The soluble form derives from the membrane form by proteolytic processing.
    N-glycosylated.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ApoL related ligand TALL 1 antibody
    • B cell Activating Factor antibody
    • B lymphocyte stimulator antibody
    • B-cell-activating factor antibody
    • BAFF antibody
    • BLyS antibody
    • CD 257 antibody
    • CD257 antibody
    • CD257 antigen antibody
    • Delta BAFF antibody
    • Dendritic cell derived TNF like molecule antibody
    • Dendritic cell-derived TNF-like molecule antibody
    • DTL antibody
    • DTL precursor antibody
    • PRO738 antibody
    • soluble form antibody
    • TALL 1 antibody
    • TALL-1 antibody
    • TALL1 antibody
    • THANK antibody
    • TN13B_HUMAN antibody
    • TNF and APOL related leukocyte expressed ligand 1 antibody
    • TNF homolog that activates apoptosis antibody
    • TNF homolog that activates apoptosis NKFB and JNK. antibody
    • TNF- and APOL-related leukocyte expressed ligand 1 antibody
    • TNFSF13B antibody
    • TNFSF20 antibody
    • TNLG7A antibody
    • Tumor necrosis factor (ligand) superfamily member 13b antibody
    • Tumor necrosis factor ligand 7A antibody
    • Tumor necrosis factor ligand superfamily member 13b antibody
    • Tumor necrosis factor ligand superfamily member 20 antibody
    • Tumor necrosis factor like protein ZTNF4 antibody
    • Tumor necrosis factor superfamily member 13B antibody
    • UNQ401 antibody
    • ZTNF4 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin embedded Human nasopharyngeal carcinoma tissue labeling BAFF with ab217329 at 1/400 dilution, followed by secondary antibody detection and DAB staining.

References

ab217329 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217329.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up