Overview

  • Product name

    Anti-BAFF-R antibody [5A9B6]
    See all BAFF-R primary antibodies
  • Description

    Mouse monoclonal [5A9B6] to BAFF-R
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human BAFF-R aa 1-78. Expressed in E.coli.
    Sequence:

    MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASS PAPRTALQPQESVGAGAGEAALPLPGLL


    Database link: Q96RJ3

  • Positive control

    • WB: BAFF-R (AA: extra 1-78) recombinant protein; BAFF-R (AA: extra 1-78)-hIgGFc transfected HEK-293 cell lysate; C6 cell lysate. Flow: Raji cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    5A9B6
  • Isotype

    IgG2b
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233775 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000.
Flow Cyt 1/200 - 1/400.

Target

  • Function

    B-cell receptor specific for TNFSF13B/TALL1/BAFF/BLyS. Promotes the survival of mature B-cells and the B-cell response.
  • Tissue specificity

    Highly expressed in spleen and lymph node, and in resting B-cells. Detected at lower levels in activated B-cells, resting CD4+ T-cells, in thymus and peripheral blood leukocytes.
  • Involvement in disease

    Defects in TNFRSF13C are the cause of immunodeficiency common variable type 4 (CVID4) [MIM:613494]; also called antibody deficiency due to BAFFR defect. CVID4 is a primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B cells is usually in the normal range, but can be low.
  • Sequence similarities

    Contains 1 TNFR-Cys repeat.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • B cell activating factor receptor antibody
    • B-cell-activating factor receptor antibody
    • BAFF R antibody
    • BAFF receptor antibody
    • BAFF-R antibody
    • BAFFR antibody
    • BLyS receptor 3 antibody
    • BlySR3 antibody
    • BR 3 antibody
    • BR3 antibody
    • BROMIX antibody
    • CD 268 antibody
    • CD268 antibody
    • CD268 antigen antibody
    • CVID4 antibody
    • MGC138235 antibody
    • OTTHUMP00000028746 antibody
    • Prolixin antibody
    • TNFRSF 13C antibody
    • Tnfrsf13c antibody
    • TR13C_HUMAN antibody
    • Tumor necrosis factor receptor subunit member 13C antibody
    • Tumor necrosis factor receptor superfamily member 13C antibody
    see all

Images

  • Flow cytometric analysis of Raji (human Burkitt's lymphoma cell line) cells labeling BAFF-R using ab233775 at 1/200 dilution (green) and the negative control (red).

  • Anti-BAFF-R antibody [5A9B6] (ab233775) at 1/500 dilution + C6 (Rat glial tumor cell line) cell lysate
  • All lanes : Anti-BAFF-R antibody [5A9B6] (ab233775) at 1/500 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : BAFF-R (AA: extra 1-78)-hIgGFc transfected HEK-293 cell lysate
  • Anti-BAFF-R antibody [5A9B6] (ab233775) at 1/500 dilution + BAFF-R (AA: extra 1-78) human recombinant protein


    Expected MW is 34 kDa.

References

ab233775 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233775.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up