Overview

  • Product name

  • Description

    Rabbit polyclonal to Bag5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human Bag5 aa 98-447 (C terminal).
    Sequence:

    FEEAQSLVREKIVPFYNGGNCVTDEFEEGIQDIILRLTHVKTGGKISLRK ARYHTLTKICAVQEIIEDCMKKQPSLPLSEDAHPSVAKINFVMCEVNKAR GVLIALLMGVNNNETCRHLSCVLSGLIADLDALDVCGRTEIRNYRREVVE DINKLLKYLDLEEEADTTKAFDLRQNHSILKIEKVLKRMREIKNELLQAQ NPSELYLSSKTELQGLIGQLDEVSLEKNPCIREARRRAVIEVQTLITYID LKEALEKRKLFACEEHPSHKAVWNVLGNLSEIQGEVLSFDGNRTDKNYIR LEELLTKQLLALDAVDPQGEEKCKAARKQAVRLAQNILSYLDLKSDEWEY


    Database link: Q9UL15

  • Positive control

    • A549, HeLa and 293T cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab182658 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 51 kDa.

Target

Images

  • All lanes : Anti-Bag5 antibody (ab182658) at 1/500 dilution

    Lane 1 : A549 cell lysate
    Lane 2 : HeLa cell lysate
    Lane 3 : 293T cell lysate

    Lysates/proteins at 40 µg per lane.

    Secondary
    All lanes : Goat anti Rabbit IgG - H&L (HRP) at 1/3000 dilution

    Predicted band size: 51 kDa


    Exposure time: 1 minute

References

ab182658 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182658.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up