Overview

  • Product name

  • Description

    Rabbit polyclonal to BANF1/BAF
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human, Pig
    Predicted to work with: Mouse, Cow, Orangutan
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human BANF1/BAF aa 2-89. Expressed in E.coli. N-terminal tags.
    Sequence:

    TTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLV LKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL


    Database link: O75531

  • Positive control

    • WB: Recombinant human BANF1/BAF; rat testis lysate; HeLa cell lysate; pig skeletal muscle lysate. IHC-P: Human stomach, kidney, cerebrum, breast cancer and glioma tissue.
  • General notes

     This product was previously labelled as BANF1

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231331 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 10 kDa.

Target

  • Function

    Plays fundamental roles in nuclear assembly, chromatin organization, gene expression and gonad development. May potently compress chromatin structure and be involved in membrane recruitment and chromatin decondensation during nuclear assembly. Contains 2 non-specific dsDNA-binding sites which may promote DNA cross-bridging. Exploited by retroviruses for inhibiting self-destructing autointegration of retroviral DNA, thereby promoting integration of viral DNA into the host chromosome. EMD and BAF are cooperative cofactors of HIV-1 infection. Association of EMD with the viral DNA requires the presence of BAF and viral integrase. The association of viral DNA with chromatin requires the presence of BAF and EMD.
  • Tissue specificity

    Widely expressed. Expressed in colon, brain, heart, kidney, liver, lung, ovary, pancreas, placenta, prostate, skeletal muscle, small intestine, spleen and testis. Not detected in thymus and peripheral blood leukocytes.
  • Sequence similarities

    Belongs to the BAF family.
  • Domain

    Has a helix-hairpin-helix (HhH) structural motif conserved among proteins that bind non-specifically to DNA.
    LEM domain proteins bind centrally on the BAF dimer, whereas DNA binds to the left and right sides.
  • Post-translational
    modifications

    Partially phosphorylated on serine. Ser-4 phosphorylation may block BAF ability to promote EMD binding to lamins in vitro. Non phosphorylated BAF seems to enhances binding between EMD and LMNA.
  • Cellular localization

    Nucleus. Cytoplasm. Chromosome. Significantly enriched at the nuclear inner membrane, diffusely throughout the nucleus during interphase and concentrated at the chromosomes during the M-phase. May be included in HIV-1 virions via its interaction with viral GAG polyprotein.
  • Information by UniProt
  • Database links

  • Alternative names

    • BAF antibody
    • BAF_HUMAN antibody
    • BANF 1 antibody
    • BANF1 antibody
    • Barrier to autointegration factor 1 antibody
    • Barrier to autointegration factor antibody
    • Barrier-to-autointegration factor antibody
    • BCRG 1 antibody
    • BCRG1 antibody
    • BCRP 1 antibody
    • BCRP1 antibody
    • Breakpoint cluster region protein 1 antibody
    • D14S1460 antibody
    • MGC111161 antibody
    • NGPS antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human skin cancer tissue stained for BANF1/BAF using ab231331 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-BANF1/BAF antibody (ab231331) at 1 µg/ml + Rat testis lysate

    Predicted band size: 10 kDa

  • Anti-BANF1/BAF antibody (ab231331) at 2 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Predicted band size: 10 kDa

  • Anti-BANF1/BAF antibody (ab231331) at 2 µg/ml + Pig skeletal muscle lysate

    Predicted band size: 10 kDa

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for BANF1/BAF using ab231331 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for BANF1/BAF using ab231331 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human cerebrum tissue stained for BANF1/BAF using ab231331 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human glioma tissue stained for BANF1/BAF using ab231331 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for BANF1/BAF using ab231331 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-BANF1/BAF antibody (ab231331) at 2 µg/ml + Recombinant human BANF1/BAF protein

    Predicted band size: 10 kDa

References

ab231331 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231331.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up