Overview

  • Product name

  • Description

    Rabbit polyclonal to BANK1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human BANK1 aa 388-473.
    Sequence:

    RHGHKELKKIFEDFSIQEIDINNEQENDYEEDIASFSTYIPSTQNPAFHH ESRKTYGQSADGAEANEMEGEGKQNGSGMETKHSPL


    Database link: Q8NDB2

  • Positive control

    • IHC-P: Human lymph node tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224160 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    BANK1 is a B cell specific scaffold protein and LYN tyrosine kinase substrate that promotes tyrosine phosphorylation of inositol 1,4,5-trisphosphate receptors.
  • Database links

  • Alternative names

    • A530094C12Rik antibody
    • AI451642 antibody
    • AVIEF antibody
    • B cell scaffold protein with ankyrin repeats 1 antibody
    • BANK antibody
    • FLJ20706 antibody
    • FLJ34204 antibody
    see all

Images

  • Paraffin-embedded human lymph node tissue stained for BANK1 using ab224160 at 1/500 dilution in immunohistochemical analysis.

References

ab224160 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224160.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up