Overview

  • Product name

    Anti-BAS1 antibody
  • Description

    Rabbit polyclonal to BAS1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Recombinant fragment
    Predicted to work with: Arabidopsis thaliana, Triticum aestivum, Hordeum vulgare, Spinacia oleracea
  • Immunogen

    Recombinant full length protein corresponding to Arabidopsis thaliana BAS1 aa 66-266.
    Sequence:

    KAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDF TFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLG DLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLG IGRSVDETMRTLQALQYIQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSA I


    Database link: Q96291

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab224746 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.

This antibody has only been tested in WB using the recombinant protein, we have no data for endogenous protein.

Target

  • Function

    May be an antioxidant enzyme particularly in the developing shoot and photosynthesizing leaf. Involved in the detoxification of alkyl hydroperoxides with reducing equivalents provided through the thioredoxin system.
  • Sequence similarities

    Belongs to the AhpC/TSA family.
    Contains 1 thioredoxin domain.
  • Post-translational
    modifications

    The Cys-119-SH group is the primary site of oxidation by H(2)O(2), and the oxidized Cys-119 (probably Cys-SOH) rapidly reacts with Cys-241-SH of the other subunit to form an intermolecular disulfide. This disulfide might subsequently be reduced by thioredoxin.
  • Cellular localization

    Plastid, chloroplast.
  • Information by UniProt
  • Database links

    • Alternative names

      • 2-Cys peroxiredoxin A antibody
      • 2-Cys peroxiredoxin BAS1 antibody
      • 2-Cys Prx A antibody
      • BAS1 antibody
      • BAS1A_ARATH antibody
      • chloroplastic antibody
      • Thiol-specific antioxidant protein A antibody
      see all

    Images

    • All lanes : Anti-BAS1 antibody (ab224746) at 1/500 dilution

      Lane 1 : 60 ng recombinant protein
      Lane 2 : 30 ng recombinant protein
      Lane 3 : 15 ng recombinant protein
      Lane 4 : 7.5 ng recombinant protein

      Secondary
      All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

      Developed using the ECL technique.

    References

    ab224746 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab224746.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up