Anti-BASP1 antibody (ab214322)
Key features and details
- Rabbit Polyclonal to BASP1
- Suitable for: WB, IHC-P
- Reacts with: Mouse, Rat
- Isotype: IgG
Overview
-
Product name
Anti-BASP1 antibody
See all BASP1 primary antibodies -
Description
Rabbit Polyclonal to BASP1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat
Predicted to work with: Human
-
Immunogen
Synthetic peptide within Human BASP1 aa 3-53 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
Sequence:GKLSKKKKGYNVNDEKAKEKDKKAEGAATEEEGTPKESEPQAAAEPAEAK E
Database link: P80723 -
Positive control
- Rat brain tissue; Mouse brain lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 50% Glycerol, 1% BSA -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab214322 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/100 - 1/1000. Predicted molecular weight: 23 kDa. | |
| IHC-P | 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Relevance
BASP1 is a brain abundant membrane bound protein with several transient phosphorylation sites and PEST motifs. BASP1 binds calmodulin, is phosphorylated by protein kinase C and undergoes N-terminal myristoylation. BASP1 is expressed specifically in nervous tissue. Intercellular signaling and nerve outgrowth are influenced by a number of proteins expressed at nerve endings and synapses of which BASP1 is one. -
Cellular localization
Cell membrane; Lipid-anchor. Cell projection; growth cone. Note: Associated with the membranes of growth cones that form the tips of elongating axons. -
Database links
- Entrez Gene: 10409 Human
- Entrez Gene: 70350 Mouse
- Entrez Gene: 64160 Rat
- Omim: 605940 Human
- SwissProt: P80723 Human
- SwissProt: Q91XV3 Mouse
- SwissProt: Q05175 Rat
- Unigene: 201641 Human
see all -
Alternative names
- 22 kDa neuronal tissue enriched acidic protein antibody
- BASP 1 antibody
- BASP1 protein antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-BASP1 antibody (ab214322)Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling with BASP1 with ab214322 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.
-
Western blot - Anti-BASP1 antibody (ab214322)Anti-BASP1 antibody (ab214322) at 1/200 dilution + Mouse brain lysate
Secondary
Goat Anti-Rabbit IgG Antibody (H+L), HRP Conjugated at 1/3000 dilution
Predicted band size: 23 kDa15% gel
Protocols
Datasheets and documents
References (0)
ab214322 has not yet been referenced specifically in any publications.
