Anti-Bax antibody (ab216494)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Bax antibody
See all Bax primary antibodies -
Description
Mouse polyclonal to Bax -
Host species
Mouse -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Rat
Predicted to work with: Human
-
Immunogen
Synthetic peptide within Human Bax aa 60-110 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
Sequence:SECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGR V
Database link: Q07812 -
Positive control
- IHC-P: Rat brain tissue. WB: Mouse cerebrum lysate.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 50% Glycerol, 1% BSA -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab216494 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/100 - 1/500. | |
| WB | 1/100 - 1/1000. Detects a band of approximately 21 kDa (predicted molecular weight: 21 kDa). |
Target
-
Function
Accelerates programmed cell death by binding to, and antagonizing the apoptosis repressor BCL2 or its adenovirus homolog E1B 19k protein. Under stress conditions, undergoes a conformation change that causes translocation to the mitochondrion membrane, leading to the release of cytochrome c that then triggers apoptosis. Promotes activation of CASP3, and thereby apoptosis. -
Tissue specificity
Expressed in a wide variety of tissues. Isoform Psi is found in glial tumors. Isoform Alpha is expressed in spleen, breast, ovary, testis, colon and brain, and at low levels in skin and lung. Isoform Sigma is expressed in spleen, breast, ovary, testis, lung, colon, brain and at low levels in skin. Isoform Alpha and isoform Sigma are expressed in pro-myelocytic leukemia, histiocytic lymphoma, Burkitt's lymphoma, T-cell lymphoma, lymphoblastic leukemia, breast adenocarcinoma, ovary adenocarcinoma, prostate carcinoma, prostate adenocarcinoma, lung carcinoma, epidermoid carcinoma, small cell lung carcinoma and colon adenocarcinoma cell lines. -
Sequence similarities
Belongs to the Bcl-2 family. -
Domain
Intact BH3 motif is required by BIK, BID, BAK, BAD and BAX for their pro-apoptotic activity and for their interaction with anti-apoptotic members of the Bcl-2 family. -
Cellular localization
Cytoplasm and Mitochondrion membrane. Cytoplasm. Colocalizes with 14-3-3 proteins in the cytoplasm. Under stress conditions, undergoes a conformation change that causes release from JNK-phosphorylated 14-3-3 proteins and translocation to the mitochondrion membrane. - Information by UniProt
-
Database links
- Entrez Gene: 581 Human
- Entrez Gene: 12028 Mouse
- Entrez Gene: 24887 Rat
- Omim: 600040 Human
- SwissProt: Q07812 Human
- SwissProt: Q07813 Mouse
- SwissProt: Q63690 Rat
- Unigene: 624291 Human
see all -
Alternative names
- Apoptosis regulator BAX antibody
- BAX antibody
- Bax-protein antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Bax antibody (ab216494)Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling Bax with ab216494 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.
-
Western blot - Anti-Bax antibody (ab216494)Anti-Bax antibody (ab216494) at 1/300 dilution + mouse cerebrum lysate
Predicted band size: 21 kDa
Observed band size: 21 kDa
Datasheets and documents
References
ab216494 has not yet been referenced specifically in any publications.
