Anti-Bax antibody (ab216494)
Key features and details
- Mouse polyclonal to Bax
- Suitable for: IHC-P, WB
- Reacts with: Mouse, Rat
- Isotype: IgG
Overview
-
Product name
Anti-Bax antibody
See all Bax primary antibodies -
Description
Mouse polyclonal to Bax -
Host species
Mouse -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Rat
Predicted to work with: Human
-
Immunogen
Synthetic peptide within Human Bax aa 60-110 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
Sequence:SECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGR V
Database link: Q07812 -
Positive control
- IHC-P: Rat brain tissue. WB: Mouse cerebrum lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 50% Glycerol, 1% BSA -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab216494 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/100 - 1/500. | |
| WB | 1/100 - 1/1000. Detects a band of approximately 21 kDa (predicted molecular weight: 21 kDa). |
Target
-
Function
Accelerates programmed cell death by binding to, and antagonizing the apoptosis repressor BCL2 or its adenovirus homolog E1B 19k protein. Under stress conditions, undergoes a conformation change that causes translocation to the mitochondrion membrane, leading to the release of cytochrome c that then triggers apoptosis. Promotes activation of CASP3, and thereby apoptosis. -
Tissue specificity
Expressed in a wide variety of tissues. Isoform Psi is found in glial tumors. Isoform Alpha is expressed in spleen, breast, ovary, testis, colon and brain, and at low levels in skin and lung. Isoform Sigma is expressed in spleen, breast, ovary, testis, lung, colon, brain and at low levels in skin. Isoform Alpha and isoform Sigma are expressed in pro-myelocytic leukemia, histiocytic lymphoma, Burkitt's lymphoma, T-cell lymphoma, lymphoblastic leukemia, breast adenocarcinoma, ovary adenocarcinoma, prostate carcinoma, prostate adenocarcinoma, lung carcinoma, epidermoid carcinoma, small cell lung carcinoma and colon adenocarcinoma cell lines. -
Sequence similarities
Belongs to the Bcl-2 family. -
Domain
Intact BH3 motif is required by BIK, BID, BAK, BAD and BAX for their pro-apoptotic activity and for their interaction with anti-apoptotic members of the Bcl-2 family. -
Cellular localization
Cytoplasm and Mitochondrion membrane. Cytoplasm. Colocalizes with 14-3-3 proteins in the cytoplasm. Under stress conditions, undergoes a conformation change that causes release from JNK-phosphorylated 14-3-3 proteins and translocation to the mitochondrion membrane. - Information by UniProt
-
Database links
- Entrez Gene: 581 Human
- Entrez Gene: 12028 Mouse
- Entrez Gene: 24887 Rat
- Omim: 600040 Human
- SwissProt: Q07812 Human
- SwissProt: Q07813 Mouse
- SwissProt: Q63690 Rat
- Unigene: 624291 Human
see all -
Alternative names
- Apoptosis regulator BAX antibody
- BAX antibody
- Bax-protein antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Bax antibody (ab216494)Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling Bax with ab216494 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.
-
Western blot - Anti-Bax antibody (ab216494)Anti-Bax antibody (ab216494) at 1/300 dilution + mouse cerebrum lysate
Predicted band size: 21 kDa
Observed band size: 21 kDa
Protocols
Datasheets and documents
References (2)
ab216494 has been referenced in 2 publications.
- Zhang W et al. Effects of Vitamin A on Expressions of Apoptosis Genes Bax and Bcl-2 in Epithelial Cells of Corneal Tissues Induced by Benzalkonium Chloride in Mice with Dry Eye. Med Sci Monit 25:4583-4589 (2019). PubMed: 31257361
- Chen K & Zhang L Effect of drug-loaded microbubbles combined with ultrasound on the apoptosis of cancer cells and the expression of Bax and Bcl-2 in a rabbit VX2 liver tumor model. Biosci Rep 39:N/A (2019). PubMed: 30578377
