Overview

  • Product name

  • Description

    Mouse polyclonal to Bax
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat
    Predicted to work with: Human
  • Immunogen

    Synthetic peptide within Human Bax aa 60-110 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    SECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGR V


    Database link: Q07812

  • Positive control

    • IHC-P: Rat brain tissue. WB: Mouse cerebrum lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab216494 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/100 - 1/1000. Detects a band of approximately 21 kDa (predicted molecular weight: 21 kDa).

Target

  • Function

    Accelerates programmed cell death by binding to, and antagonizing the apoptosis repressor BCL2 or its adenovirus homolog E1B 19k protein. Under stress conditions, undergoes a conformation change that causes translocation to the mitochondrion membrane, leading to the release of cytochrome c that then triggers apoptosis. Promotes activation of CASP3, and thereby apoptosis.
  • Tissue specificity

    Expressed in a wide variety of tissues. Isoform Psi is found in glial tumors. Isoform Alpha is expressed in spleen, breast, ovary, testis, colon and brain, and at low levels in skin and lung. Isoform Sigma is expressed in spleen, breast, ovary, testis, lung, colon, brain and at low levels in skin. Isoform Alpha and isoform Sigma are expressed in pro-myelocytic leukemia, histiocytic lymphoma, Burkitt's lymphoma, T-cell lymphoma, lymphoblastic leukemia, breast adenocarcinoma, ovary adenocarcinoma, prostate carcinoma, prostate adenocarcinoma, lung carcinoma, epidermoid carcinoma, small cell lung carcinoma and colon adenocarcinoma cell lines.
  • Sequence similarities

    Belongs to the Bcl-2 family.
  • Domain

    Intact BH3 motif is required by BIK, BID, BAK, BAD and BAX for their pro-apoptotic activity and for their interaction with anti-apoptotic members of the Bcl-2 family.
  • Cellular localization

    Cytoplasm and Mitochondrion membrane. Cytoplasm. Colocalizes with 14-3-3 proteins in the cytoplasm. Under stress conditions, undergoes a conformation change that causes release from JNK-phosphorylated 14-3-3 proteins and translocation to the mitochondrion membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Apoptosis regulator BAX antibody
    • BAX antibody
    • Bax-protein antibody
    • BAX_HUMAN antibody
    • BAXA antibody
    • Baxdelta2G9 antibody
    • Baxdelta2G9omega antibody
    • Baxdelta2omega antibody
    • Bcl-2-like protein 4 antibody
    • BCL2 associated X protein antibody
    • BCL2 associated X protein omega antibody
    • BCL2 associated X protein transcript variant delta2 antibody
    • Bcl2-L-4 antibody
    • BCL2L4 antibody
    • membrane isoform alpha antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling Bax with ab216494 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Anti-Bax antibody (ab216494) at 1/300 dilution + mouse cerebrum lysate

    Predicted band size: 21 kDa
    Observed band size: 21 kDa

References

ab216494 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216494.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up