Overview

  • Product name

  • Description

    Mouse polyclonal to BAZ2A/TIP5
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human BAZ2A/TIP5 aa 1-1905.
    Sequence:

    MEMEANDHFNFTGLPPAPAASGLKPSPSSGEGLYTNGSPMNFPQQGKSLN GDVNVNGLSTVSHTTTSGILNSAPHSSSTSHLHHPSVAYDCLWNYSQYPS ANPGSNLKDPPLLSQFSGGQYPLNGILGGSRQPSSPSHNTNLRAGSQEFW ANGTQSPMGLNFDSQELYDSFPDQNFEVMPNGPPSFFTSPQTSPMLGSSI QTFAPSQEVGSGIHPDEAAEKEMTSVVAENGTGLVGSLELEEEQPELKMC GYNGSVPSVESLHQEVSVLVPDPTVSCLDDPSHLPDQLEDTPILSEDSLE PFNSLAPEPVSGGLYGIDDTELMGAEDKLPLEDSPVISALDCPSLNNATA FSLLADDSQTSTSIFASPTSPPVLGESVLQDNSFDLNNGSDAEQEEMETQ SSDFPPSLTQPAPDQSSTIQLHPATSPAVSPTTSPAVSLVVSPAASPEIS PEVCPAASTVVSPAVFSVVSPASSAVLPAVSLEVPLTASVTSPKASPVTS PAAAFPTASPANKDVSSFLETTADVEEITGEGLTASGSGDVMRRRIATPE EVRLPLQHGWRREVRIKKGSHRWQGETWYYGPCGKRMKQFPEVIKYLSRN VVHSVRREHFSFSPRMPVGDFFEERDTPEGLQWVQLSAEEIPSRIQAITG KRGRPRNTEKAKTKEVPKVKRGRGRPPKVKITELLNKTDNRPLKKLEAQE TLNEEDKAKIAKSKKKMRQKVQRGECQTTIQGQARNKRKQETKSLKQKEA KKKSKAEKEKGKTKQEKLKEKVKREKKEKVKMKEKEEVTKAKPACKADKT LATQRRLEERQRQQMILEEMKKPTEDMCLTDHQPLPDFSRVPGLTLPSGA FSDCLTIVEFLHSFGKVLGFDPAKDVPSLGVLQEGLLCQGDSLGEVQDLL VRLLKAALHDPGFPSYCQSLKILGEKVSEIPLTRDNVSEILRCFLMAYGV EPALCDRLRTQPFQAQPPQQKAAVLAFLVHELNGSTLIINEIDKTLESMS SYRKNKWIVEGRLRRLKTVLAKRTGRSEVEMEGPEECLGRRRSSRIMEET SGMEEEEEEESIAAVPGRRGRRDGEVDATASSIPELERQIEKLSKRQLFF RKKLLHSSQMLRAVSLGQDRYRRRYWVLPYLAGIFVEGTEGNLVPEEVIK KETDSLKVAAHASLNPALFSMKMELAGSNTTASSPARARGRPRKTKPGSM QPRHLKSPVRGQDSEQPQAQLQPEAQLHAPAQPQPQLQLQLQSHKGFLEQ EGSPLSLGQSQHDLSQSAFLSWLSQTQSHSSLLSSSVLTPDSSPGKLDPA PSQPPEEPEPDEAESSPDPQALWFNISAQMPCNAAPTPPPAVSEDQPTPS PQQLASSKPMNRPSAANPCSPVQFSSTPLAGLAPKRRAGDPGEMPQSPTG LGQPKRRGRPPSKFFKQMEQRYLTQLTAQPVPPEMCSGWWWIRDPEMLDA MLKALHPRGIREKALHKHLNKHRDFLQEVCLRPSADPIFEPRQLPAFQEG IMSWSPKEKTYETDLAVLQWVEELEQRVIMSDLQIRGWTCPSPDSTREDL AYCEHLSDSQEDITWRGRGREGLAPQRKTTNPLDLAVMRLAALEQNVERR YLREPLWPTHEVVLEKALLSTPNGAPEGTTTEISYEITPRIRVWRQTLER CRSAAQVCLCLGQLERSIAWEKSVNKVTCLVCRKGDNDEFLLLCDGCDRG CHIYCHRPKMEAVPEGDWFCTVCLAQQVEGEFTQKPGFPKRGQKRKSGYS LNFSEGDGRRRRVLLRGRESPAAGPRYSEEGLSPSKRRRLSMRNHHSDLT FCEIILMEMESHDAAWPFLEPVNPRLVSGYRRIIKNPMDFSTMRERLLRG GYTSSEEFAADALLVFDNCQTFNEDDSEVGKAGHIMRRFFESRWEEFYQG KQANL


    Database link: NP_038477.2

  • Positive control

    • BAZ2A/TIP5 transfected 293T cell line.
  • General notes

     This product was previously labelled as BAZ2A

     

Properties

Applications

Our Abpromise guarantee covers the use of ab168529 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 208 kDa.

Target

  • Relevance

    BAZ2A is a bromodomain adjacent to a zinc finger domain protein. It may play a role in transcriptional regulation interacting with ISWI and may serve a specific role in maintaining or altering the chromatin structure of the rDNA locus. BAz2A colocalizes with the basal RNA polymerase I transcription factor UBF in the nucleolus.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • Bromodomain adjacent to zinc finger domain 2A antibody
    • Tip5 antibody
    • Transcription termination factor I interacting protein 5 antibody
    • TTF I interacting protein 5 antibody
    • WALp3 antibody
    see all

Images

  • All lanes : Anti-BAZ2A/TIP5 antibody (ab168529) at 1 µg/ml

    Lane 1 : BAZ2A/TIP5 transfected 293T lysate
    Lane 2 : Non-transfected 293T lysate

    Lysates/proteins at 15 µl per lane.

    Predicted band size: 208 kDa

References

ab168529 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168529.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up