Overview

  • Product name

    Anti-BBS10 antibody
  • Description

    Rabbit polyclonal to BBS10
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human BBS10 aa 435-552.
    Sequence:

    QTNDQNGTSSLFIYKNSGESYQAPDPGNGSIQRPYQDTVAENKDALEKTQ TYLKVHSNLVIPDVELETYIPYSTPTLTPTDTFQTVETLTCLSLERNRLT DYYEPLLKNNSTAYSTRG


    Database link: Q8TAM1

  • Positive control

    • IHC-P: Human liver cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab222884 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Relevance

    BBS10 belongs to the TCP-1 chaperonin family. It is a probable molecular chaperone; assist the folding of proteins upon ATP hydrolysis. Defects in BBS10 are the cause of Bardet-Biedl syndrome type 10 (BBS10) [MIM:209900]. Bardet-Biedl syndrome (BBS) is a genetically heterogeneous, autosomal recessive disorder characterized by usually severe pigmentary retinopathy, early onset obesity, polydactyly, hypogenitalism, renal malformation and mental retardation.
  • Cellular localization

    Cell projection; cilium. Note: Located within the basal body of the primary cilium of differentiating preadipocytes.
  • Database links

  • Alternative names

    • 1300007O09Rik antibody
    • AI452285 antibody
    • Bardet Biedl syndrome 10 protein antibody
    • Bardet Biedl syndrome 10 protein homolog antibody
    • Bardet-Biedl syndrome 10 antibody
    • C12orf58 antibody
    • Chromosome 12 open reading frame 58 antibody
    • FLJ23560 antibody
    • RGD1560748 antibody
    see all

Images

  • Paraffin-embedded human liver cancer tissue stained for BBS10 using ab222884 at 1/100 dilution in immunohistochemical analysis.

References

ab222884 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222884.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up