Overview

  • Product name

  • Description

    Rabbit polyclonal to BBS5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human BBS5 aa 220-270 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    LVIESSQQSGGYVLGFKIDPVEKLQESVKEINSLHKVYSASPIFGVDYEM E


    Database link: Q8N3I7

  • Positive control

    • Rat brain, human kidney tissue.

Properties

  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 0.01% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab203621 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

When using a fluorescent probe the recommended dilution is 1/50 – 1/200

WB 1/100 - 1/1000. Predicted molecular weight: 39 kDa.

Target

  • Function

    The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia. The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This ciliogenic function is mediated in part by the Rab8 GDP/GTP exchange factor, which localizes to the basal body and contacts the BBSome. Rab8(GTP) enters the primary cilium and promotes extension of the ciliary membrane. Firstly the BBSome associates with the ciliary membrane and binds to RAB3IP/Rabin8, the guanosyl exchange factor (GEF) for Rab8 and then the Rab8-GTP localizes to the cilium and promotes docking and fusion of carrier vesicles to the base of the ciliary membrane. The BBSome complex, together with the LTZL1, controls SMO ciliary trafficking and contributes to the sonic hedgehog (SHH) pathway regulation. Required for BBSome complex ciliary localization but not for the proper complex assembly.
  • Involvement in disease

    Bardet-Biedl syndrome 5
  • Sequence similarities

    Belongs to the BBS5 family.
  • Cellular localization

    Cell projection, cilium membrane. Cytoplasm. Cytoplasm, cytoskeleton, cilium basal body. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriolar satellite. Localizes to basal bodies.
  • Information by UniProt
  • Database links

  • Alternative names

    • Bardet Biedl syndrome 5 protein antibody
    • Bardet-Biedl syndrome 5 protein antibody
    • BBS5 antibody
    • BBS5_HUMAN antibody

Images

  • Immunohistochemical analysis of formalin-fixed and paraffin embedded rat liver labeling BBS5 with ab203621 at 1/200 followed by conjugation to the secondary antibody and DAB staining

  • Immunohistochemical analysis of formalin-fixed and paraffin embedded human kidney labeling BBS5 with ab203621 at 1/200 followed by conjugation to the secondary antibody and DAB staining

References

ab203621 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203621.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up