Overview

  • Product name

  • Description

    Rabbit polyclonal to BBX
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human BBX aa 208-336.
    Sequence:

    LSMLLLAGEHALGTPEVSSGTCRPDVSESPELRQKSPLFQFAEISSSTSH SDASTKQCQTSALFQFAEISSNTSQLGGAEPVKRCGKSALFQLAEMCL ASEGMKMEESKLIKAKESDGGRIKELEKGKE


    Database link: Q8WY36

  • Positive control

    • Human rectum tissue; A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab204176 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

Images

  • Immunofluorescent analysis of A431 cells (PFA-fixed/Triton X-100 permeabilized) labeling BBX with ab204176 at 4 µg/ml (green).

  • Immunohistochemical analysis of paraffin-embedded Human rectum tissue labeling BBX with ab204176 at 1/1000 dilution.

References

ab204176 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204176.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up