Overview

  • Product name

  • Description

    Rabbit polyclonal to BCA1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Human
  • Immunogen

    Synthetic peptide within Human BCA1 aa 41-90 (internal sequence). The exact sequence is proprietary.
    Sequence:

    VFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEV


    Database link: O43927

  • Positive control

    • Mouse spleen cells extract.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, 49% PBS, 0.87% Sodium chloride

    PBS without Mg2+ and Ca2+
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab190662 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 13 kDa.

Target

  • Function

    Chemotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5.
  • Tissue specificity

    Highest levels in liver, followed by spleen, lymph node, appendix and stomach. Low levels in salivary gland, mammary gland and fetal spleen.
  • Sequence similarities

    Belongs to the intercrine alpha (chemokine CxC) family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • ANGIE antibody
    • ANGIE2 antibody
    • B cell attracting chemokine 1 antibody
    • B cell-attracting chemokine 1 antibody
    • B lymphocyte chemoattractant antibody
    • B-cell chemoattractant antibody
    • B-cell-attracting chemokine 1 antibody
    • B-cell-homing chemokine (ligand for Burkitt's lymphoma receptor-1) antibody
    • BCA-1 antibody
    • BLC antibody
    • BLR1L antibody
    • C-X-C motif chemokine 13 antibody
    • Chemokine (C-X-C motif) ligand 13 antibody
    • Chemokine (C-X-C motif) ligand 13 (B-cell chemoattractant) antibody
    • Chemokine, CXC motif, ligand 13 antibody
    • CXC chemokine BLC antibody
    • CXCL13 antibody
    • CXL13_HUMAN antibody
    • SCYB13 antibody
    • Small inducible cytokine B subfamily (Cys-X-Cys motif), member 13 (B-cell chemoattractant) antibody
    • Small inducible cytokine B13 antibody
    • Small inducible cytokine subfamily B, member 13 antibody
    • Small-inducible cytokine B13 antibody
    see all

Images

  • Anti-BCA1 antibody (ab190662) at 1/500 dilution + mouse spleen cells extract at 30 µg

    Predicted band size: 13 kDa

References

ab190662 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190662.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up