Overview

  • Product name

  • Description

    Rabbit polyclonal to BCA1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISAmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human BCA1 aa 23-109.
    Sequence:

    VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNK SIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP


    Database link: O43927

  • Positive control

    • WB: HeLa whole cell lysate.

Properties

  • Form

    Lyophilised:0.2 ml of distilled water will yield a concentration of 500 ug/ml. Can be stored for up to one month at 4°C after reconstitution.
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Stable for 12 months at -20°C.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituents: 0.9% Sodium chloride, 0.2% Dibasic monohydrogen sodium phosphate, 4% Trehalose
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab227801 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.1 - 0.5 µg/ml. Predicted molecular weight: 13 kDa.
ELISA Use a concentration of 1 - 5 µg/ml.

Capture antibody.

Target

  • Function

    Chemotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5.
  • Tissue specificity

    Highest levels in liver, followed by spleen, lymph node, appendix and stomach. Low levels in salivary gland, mammary gland and fetal spleen.
  • Sequence similarities

    Belongs to the intercrine alpha (chemokine CxC) family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • ANGIE antibody
    • ANGIE2 antibody
    • B cell attracting chemokine 1 antibody
    • B cell-attracting chemokine 1 antibody
    • B lymphocyte chemoattractant antibody
    • B-cell chemoattractant antibody
    • B-cell-attracting chemokine 1 antibody
    • B-cell-homing chemokine (ligand for Burkitt's lymphoma receptor-1) antibody
    • BCA-1 antibody
    • BLC antibody
    • BLR1L antibody
    • C-X-C motif chemokine 13 antibody
    • Chemokine (C-X-C motif) ligand 13 antibody
    • Chemokine (C-X-C motif) ligand 13 (B-cell chemoattractant) antibody
    • Chemokine, CXC motif, ligand 13 antibody
    • CXC chemokine BLC antibody
    • CXCL13 antibody
    • CXL13_HUMAN antibody
    • SCYB13 antibody
    • Small inducible cytokine B subfamily (Cys-X-Cys motif), member 13 (B-cell chemoattractant) antibody
    • Small inducible cytokine B13 antibody
    • Small inducible cytokine subfamily B, member 13 antibody
    • Small-inducible cytokine B13 antibody
    see all

Images

  • Anti-BCA1 antibody (ab227801) at 0.5 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate at 40 µg

    Predicted band size: 13 kDa
    Observed band size: 13 kDa

  • ELISA using ab227801 as capture antibody at 4 µg/ml. 

References

This product has been referenced in:

  • Pan BL  et al. Up-regulation of microRNA-340 promotes osteosarcoma cell apoptosis while suppressing proliferation, migration, and invasion by inactivating the CTNNB1-mediated Notch signaling pathway. Biosci Rep 38:N/A (2018). Read more (PubMed: 29769415) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab227801.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up