Overview

  • Product name

  • Description

    Rabbit polyclonal to BCAT1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat BCAT1 aa 179-411. Two N-terminal tags, (Expressed in E.coli).
    Sequence:

    YSTSASLYIRPTFIGIEPSLGVKKPSKALLFVILSPVGSYFSNGTFSPVS LWANPKFVRSWKGGTGDFKMGCNYGSSLLAQCEAAENGCHQVLWLYGKEN RITEVGTMNLFLYWINKDGEEELATPPLDGVILPGVTRQSILELGEEWGE FKVCERHITMDDLSTALEENRVKEMFGSGTACVVCPVASILYKGQMLHIP TMENGHKLSSRIMAKLTDIQYGRIKSEWTLELP


    Database link: P54690

  • Positive control

    • WB: Mouse heart and cerebrum lysate; Rat cerebrum lysate; Recombinant rat BCAT1 protein. IHC-P: Rat testis, heart and brain tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232706 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml.

Target

  • Function

    Catalyzes the first reaction in the catabolism of the essential branched chain amino acids leucine, isoleucine, and valine.
  • Tissue specificity

    During embryogenesis, expressed in the brain and kidney. Overexpressed in MYC-induced tumors such as Burkitt's lymphoma.
  • Sequence similarities

    Belongs to the class-IV pyridoxal-phosphate-dependent aminotransferase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • BCAT antibody
    • BCAT(c) antibody
    • Bcat1 antibody
    • BCAT1_HUMAN antibody
    • BCT1 antibody
    • Branched chain amino acid aminotransferase, cytosolic antibody
    • branched chain amino-acid transaminase 1, cytosolic antibody
    • branched chain aminotransferase 1 antibody
    • branched chain aminotransferase 1, cytosolic antibody
    • Branched-chain-amino-acid aminotransferase antibody
    • cytosolic antibody
    • DKFZp686E12175 antibody
    • EC 2.6.1.42 antibody
    • ECA39 antibody
    • MECA39 antibody
    • placental protein 18 antibody
    • PNAS 121 antibody
    • PP18 antibody
    • Protein ECA39 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat brain tissue stained for BCAT1 using ab232706 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat heart tissue stained for BCAT1 using ab232706 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat testis tissue stained for BCAT1 using ab232706 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-BCAT1 antibody (ab232706) at 1 µg/ml + Mouse cerebrum lysate
  • Anti-BCAT1 antibody (ab232706) at 1 µg/ml + Rat cerebrum lysate
  • Anti-BCAT1 antibody (ab232706) at 1 µg/ml + Mouse heart lysate
  • Anti-Calcium-independent Phospholipase A2/PLA2G6 antibody (ab23706) at 1 µg/ml + Recombinant rat BCAT1 protein

References

ab232706 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232706.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up