Overview

  • Product name

  • Description

    Rabbit polyclonal to BCAT1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Sheep
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human BCAT1 aa 174-386. (Expressed in E.coli).
    Sequence:

    GVKKPTKALLFVLLSPVGPYFSSGTFNPVSLWANPKYVRAWKGGTGDCKM GGNYGSSLFAQCEAVDNGCQQVLWLYGEDHQITEVGTMNLFLYWINEDGE EELATPPLDGIILPGVTRRCILDLAHQWGEFKVSERYLTMDDLTTALEGN RVREMFGSGTACVVCPVSDILYKGETIHIPTMENGPKLASRILSKLTDIQ YGREESDWTIVLS


    Database link: P54687

  • Positive control

    • IHC-P: Human kidney tissue. WB: Recombinant human BCAT1 protein; Rat cerebrum lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab232918 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232918 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 43 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Catalyzes the first reaction in the catabolism of the essential branched chain amino acids leucine, isoleucine, and valine.
  • Tissue specificity

    During embryogenesis, expressed in the brain and kidney. Overexpressed in MYC-induced tumors such as Burkitt's lymphoma.
  • Sequence similarities

    Belongs to the class-IV pyridoxal-phosphate-dependent aminotransferase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • BCAT antibody
    • BCAT(c) antibody
    • Bcat1 antibody
    • BCAT1_HUMAN antibody
    • BCT1 antibody
    • Branched chain amino acid aminotransferase, cytosolic antibody
    • branched chain amino-acid transaminase 1, cytosolic antibody
    • branched chain aminotransferase 1 antibody
    • branched chain aminotransferase 1, cytosolic antibody
    • Branched-chain-amino-acid aminotransferase antibody
    • cytosolic antibody
    • DKFZp686E12175 antibody
    • EC 2.6.1.42 antibody
    • ECA39 antibody
    • MECA39 antibody
    • placental protein 18 antibody
    • PNAS 121 antibody
    • PP18 antibody
    • Protein ECA39 antibody
    see all

Images

  • Anti-BCAT1 antibody (ab232918) at 2 µg/ml + Rat cerebrum lysate

    Predicted band size: 43 kDa

  • Anti-BCAT1 antibody (ab232918) at 2 µg/ml + Recombinant human BCAT1 protein

    Predicted band size: 43 kDa

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for BCAT1 using ab232918 at 20µg/mL in immunohistochemical analysis. DAB staining.

References

ab232918 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232918.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up